(data stored in ACNUC7421 zone)

EMBL: CP002160.PE49

CP002160.PE49        Location/Qualifiers
FT   CDS             90609..90953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0051"
FT                   /product="uncharacterized protein family UPF0133"
FT                   /note="PFAM: uncharacterized protein family UPF0133; KEGG:
FT                   cac:CAC0126 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49840"
FT                   /db_xref="GOA:D9SMQ5"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ5"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ADL49840.1"
FT                   /translation="MARGFGGGGFGGGNMNNLLKQAQKMQQQMEDMKKDIENKHFSASV
FT                   GGGVVTAVVTGKKDIVSLKLNEEVVDPDDIETLEDLIVSALSEAMKKADEETSKEFGKI
FT                   TGGMNIPGMF"
     MARGFGGGGF GGGNMNNLLK QAQKMQQQME DMKKDIENKH FSASVGGGVV TAVVTGKKDI        60
     VSLKLNEEVV DPDDIETLED LIVSALSEAM KKADEETSKE FGKITGGMNI PGMF             114
//

If you have problems or comments...

PBIL Back to PBIL home page