(data stored in ACNUC7421 zone)

EMBL: CP002160.PE490

CP002160.PE490       Location/Qualifiers
FT   CDS             626252..626458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbk:CLL_A1795 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50281"
FT                   /db_xref="GOA:D9SQZ3"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ3"
FT                   /inference="similar to AA sequence:KEGG:CLL_A1795"
FT                   /protein_id="ADL50281.1"
FT                   /translation="MQREHYLVKGLANENMKTQVRNALEDLDGVNKVCIDAARGSIEVI
FT                   YKNPATTDEIRNAIERTGNIIES"
     MQREHYLVKG LANENMKTQV RNALEDLDGV NKVCIDAARG SIEVIYKNPA TTDEIRNAIE        60
     RTGNIIES                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page