(data stored in ACNUC7421 zone)

EMBL: CP002160.PE493

CP002160.PE493       Location/Qualifiers
FT   CDS             complement(627840..628418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0509"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="KEGG: cth:Cthe_2996 PfpI family intracellular
FT                   peptidase; TIGRFAM: intracellular protease, PfpI family;
FT                   PFAM: ThiJ/PfpI domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50284"
FT                   /db_xref="GOA:D9SQZ6"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ6"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ADL50284.1"
FT                   /translation="MSMKILMLLGDYVEDYEVMVPFQALQMVGFTVDTVCPDKKAGDII
FT                   RTAIHDFEGDQTYSEKRGHNFALNTDFNSINLSDYVALVIPGGRAPEYIRLNKRVIEIV
FT                   KTFANDNKPIAAICHGIQVLTAADVIKGKTISAYPALEPDVLMVGGTYINLEFDQAHVD
FT                   GNFITAPAWPAHPQWLAKFLEVLGVKISL"
     MSMKILMLLG DYVEDYEVMV PFQALQMVGF TVDTVCPDKK AGDIIRTAIH DFEGDQTYSE        60
     KRGHNFALNT DFNSINLSDY VALVIPGGRA PEYIRLNKRV IEIVKTFAND NKPIAAICHG       120
     IQVLTAADVI KGKTISAYPA LEPDVLMVGG TYINLEFDQA HVDGNFITAP AWPAHPQWLA       180
     KFLEVLGVKI SL                                                           192
//

If you have problems or comments...

PBIL Back to PBIL home page