(data stored in ACNUC7421 zone)

EMBL: CP002160.PE494

CP002160.PE494       Location/Qualifiers
FT   CDS             628910..630790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0510"
FT                   /product="Heat shock protein Hsp90-like"
FT                   /note="KEGG: cbh:CLC_1931 heat shock protein 90; PFAM: Heat
FT                   shock protein Hsp90-like; ATP-binding region ATPase domain
FT                   protein; SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50285"
FT                   /db_xref="GOA:D9SQZ7"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:D9SQZ7"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ADL50285.1"
FT                   /translation="METKQFKAESKRLLDLMINSIYTHREIFLRELISNASDAIDKIYY
FT                   KALTDESVSFDKENYYIRVEADRENRILKISDTGIGMTKEDLDENLGVIAKSGSLKFKK
FT                   ENELKDGYDIIGQFGVGFYSAFMVAETVTVVSKAFGSDSAYKWESQGVDGYTIEACEKD
FT                   TVGTEITLKIKANTEDENYDEYLEEYRLKSIIKKYSDFIRYPIKMEVTKNRLKEGSDKE
FT                   YEEYKEEQTVNSMVPIWKKNKNELKDEDYDSFYSEKHYGFDKPLKHIHISVDGAVSYNA
FT                   ILYIPEKMPYDFYTKEYEKGLELYSNGVMIMNKCGELIPDYFGFVKGIVDSEDLSLNIS
FT                   REILQHDRQLKLIAKNIKTKIKNELEDMIKNERESYEKFFESFGRQLKYGIYSDFGSNK
FT                   EVLQDLLLFYSSKEKKMVSLEEYVSRMPEDQKYIYYATGESVERIEKLPQTEVVLDKGY
FT                   EILYFTDDVDEFAIKMIMQYKEKEFKSVSSGDLGIEPEENDKTSEAEEKESKELFDSMK
FT                   EILSDKIKAVRSSKRLKNHPVCLTNDGDLSIEMEKVLNAMPNSEHVKADKILEININHD
FT                   VFKALKEANENDKDKLELYTNLLYNQALLIEGLPINDPVEFTNNICKIMK"
     METKQFKAES KRLLDLMINS IYTHREIFLR ELISNASDAI DKIYYKALTD ESVSFDKENY        60
     YIRVEADREN RILKISDTGI GMTKEDLDEN LGVIAKSGSL KFKKENELKD GYDIIGQFGV       120
     GFYSAFMVAE TVTVVSKAFG SDSAYKWESQ GVDGYTIEAC EKDTVGTEIT LKIKANTEDE       180
     NYDEYLEEYR LKSIIKKYSD FIRYPIKMEV TKNRLKEGSD KEYEEYKEEQ TVNSMVPIWK       240
     KNKNELKDED YDSFYSEKHY GFDKPLKHIH ISVDGAVSYN AILYIPEKMP YDFYTKEYEK       300
     GLELYSNGVM IMNKCGELIP DYFGFVKGIV DSEDLSLNIS REILQHDRQL KLIAKNIKTK       360
     IKNELEDMIK NERESYEKFF ESFGRQLKYG IYSDFGSNKE VLQDLLLFYS SKEKKMVSLE       420
     EYVSRMPEDQ KYIYYATGES VERIEKLPQT EVVLDKGYEI LYFTDDVDEF AIKMIMQYKE       480
     KEFKSVSSGD LGIEPEENDK TSEAEEKESK ELFDSMKEIL SDKIKAVRSS KRLKNHPVCL       540
     TNDGDLSIEM EKVLNAMPNS EHVKADKILE ININHDVFKA LKEANENDKD KLELYTNLLY       600
     NQALLIEGLP INDPVEFTNN ICKIMK                                            626
//

If you have problems or comments...

PBIL Back to PBIL home page