(data stored in ACNUC7421 zone)

EMBL: CP002160.PE498

CP002160.PE498       Location/Qualifiers
FT   CDS             635502..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0514"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1075
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50289"
FT                   /db_xref="GOA:D9SR01"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR01"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL50289.1"
FT                   /translation="MEKKLKRYFPIFALPTIVAFSIAFFIPFVLGIYLSFTEFTTVVDA
FT                   KWVGFENYYKAFVDKDFLNALWFTVKFTVISVIAINVLAFSLALLLTRGKKGTNVFRTV
FT                   FFMPNLIGGIVLGYIWQLIINGVLYKFGVTLTYDAKYGFWGLVILMNWQLIGYMMIIYI
FT                   AGIQNIPKDLIEAAKIDGANLFTVLKSVIVPLVMPSITICLFLTLSNSFKLFDQNLALT
FT                   AGAPSKQTAMLALDIYNTFYGKVGYEGVGQAKAVIFFILVAIIAFVQLIITRSKEVEN"
     MEKKLKRYFP IFALPTIVAF SIAFFIPFVL GIYLSFTEFT TVVDAKWVGF ENYYKAFVDK        60
     DFLNALWFTV KFTVISVIAI NVLAFSLALL LTRGKKGTNV FRTVFFMPNL IGGIVLGYIW       120
     QLIINGVLYK FGVTLTYDAK YGFWGLVILM NWQLIGYMMI IYIAGIQNIP KDLIEAAKID       180
     GANLFTVLKS VIVPLVMPSI TICLFLTLSN SFKLFDQNLA LTAGAPSKQT AMLALDIYNT       240
     FYGKVGYEGV GQAKAVIFFI LVAIIAFVQL IITRSKEVEN                             280
//

If you have problems or comments...

PBIL Back to PBIL home page