(data stored in ACNUC7421 zone)

EMBL: CP002160.PE499

CP002160.PE499       Location/Qualifiers
FT   CDS             636344..637177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0515"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1076
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50290"
FT                   /db_xref="GOA:D9SR02"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR02"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADL50290.1"
FT                   /translation="MKSEKLRDNLIFVTLSILTIVFLLPILIVIMNSFKGKFYISETPF
FT                   LLPNSSTFVGFSNYIEGVTKTGFVQAFGWSVFITVFSVAVIILFTSMTAWFITRVKSKF
FT                   TSFLYYLFAFSMIVPFQMVMFTMTKVANVTHLDNPVGIIVIYLGFASGLSVFMFSGFVK
FT                   SIPLEIEEAAVIDGCNPIQTFFMIVFPVLKPTAITVAILNAMWIWNDYLLPYLIIGNEY
FT                   KTIPIAIQYLKGGYGSIDMGAMMAVLVLAIIPIVIFYFVCQKHIIEGVVAGAVKG"
     MKSEKLRDNL IFVTLSILTI VFLLPILIVI MNSFKGKFYI SETPFLLPNS STFVGFSNYI        60
     EGVTKTGFVQ AFGWSVFITV FSVAVIILFT SMTAWFITRV KSKFTSFLYY LFAFSMIVPF       120
     QMVMFTMTKV ANVTHLDNPV GIIVIYLGFA SGLSVFMFSG FVKSIPLEIE EAAVIDGCNP       180
     IQTFFMIVFP VLKPTAITVA ILNAMWIWND YLLPYLIIGN EYKTIPIAIQ YLKGGYGSID       240
     MGAMMAVLVL AIIPIVIFYF VCQKHIIEGV VAGAVKG                                277
//

If you have problems or comments...

PBIL Back to PBIL home page