(data stored in ACNUC7421 zone)

EMBL: CP002160.PE5

CP002160.PE5         Location/Qualifiers
FT   CDS             4556..4819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0005"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbf:CLI_0005 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49796"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML1"
FT                   /inference="similar to AA sequence:KEGG:CLI_0005"
FT                   /protein_id="ADL49796.1"
FT                   /translation="MFLHLGENVVVPVRDVIGIFDIDTTMYGADTVQFLRLAEEDGFIE
FT                   KITNDKPKSFIVAEVNKKSKIFLSPISSATLCKRTQSIYEEY"
     MFLHLGENVV VPVRDVIGIF DIDTTMYGAD TVQFLRLAEE DGFIEKITND KPKSFIVAEV        60
     NKKSKIFLSP ISSATLCKRT QSIYEEY                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page