(data stored in ACNUC7421 zone)

EMBL: CP002160.PE500

CP002160.PE500       Location/Qualifiers
FT   CDS             637215..638693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0516"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="TIGRFAM: 4-alpha-glucanotransferase; KEGG:
FT                   lba:Lebu_1529 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50291"
FT                   /db_xref="GOA:D9SR03"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR03"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ADL50291.1"
FT                   /translation="MRKSGVLLPVASLPSKYGIGAFSKNAYKFIDQLKAAGQSYWQILP
FT                   LGPTGYGDSPYQSFSTFAGNPYFIDLEELIAEGYLTEEECESYDFGDNERYIDYEKIYL
FT                   SRFKILKIAFGRSNIKETEEFQKFIANNAYWLEDYALYMAVKNYFDGVSWIKWDDDIRL
FT                   RKKSALEKYKSKLEDEIAFYQFQQFLFNKQWEALKEYANEADIKIIGDIPIYVAFDSAD
FT                   SWAHPELFQFDENGEPIAVAGCPPDGFSATGQLWGNPLYNWDYHEKTEYKWWVERIAYS
FT                   FKLYDVVRVDHFRGFDEYYSIPYGSETAEIGSWEKGPGYEIFKEVRKQLGEVNIIAEDL
FT                   GFLTESVLKLVEETGYPGMKVLEFAFDSREESDYLPHNYVKNCIVYTGTHDNETIVGWY
FT                   KNLNPDDKKLAIDYLDIKDKTDEDIHWKFIKLALSSVANLAIIPLQDYLGLGNEARINT
FT                   PSTVGGNWKWRLLEDEITEELVEKINKVTKLYGR"
     MRKSGVLLPV ASLPSKYGIG AFSKNAYKFI DQLKAAGQSY WQILPLGPTG YGDSPYQSFS        60
     TFAGNPYFID LEELIAEGYL TEEECESYDF GDNERYIDYE KIYLSRFKIL KIAFGRSNIK       120
     ETEEFQKFIA NNAYWLEDYA LYMAVKNYFD GVSWIKWDDD IRLRKKSALE KYKSKLEDEI       180
     AFYQFQQFLF NKQWEALKEY ANEADIKIIG DIPIYVAFDS ADSWAHPELF QFDENGEPIA       240
     VAGCPPDGFS ATGQLWGNPL YNWDYHEKTE YKWWVERIAY SFKLYDVVRV DHFRGFDEYY       300
     SIPYGSETAE IGSWEKGPGY EIFKEVRKQL GEVNIIAEDL GFLTESVLKL VEETGYPGMK       360
     VLEFAFDSRE ESDYLPHNYV KNCIVYTGTH DNETIVGWYK NLNPDDKKLA IDYLDIKDKT       420
     DEDIHWKFIK LALSSVANLA IIPLQDYLGL GNEARINTPS TVGGNWKWRL LEDEITEELV       480
     EKINKVTKLY GR                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page