(data stored in ACNUC7421 zone)

EMBL: CP002160.PE501

CP002160.PE501       Location/Qualifiers
FT   CDS             638953..639984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0517"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="KEGG: cpy:Cphy_1077 LacI family transcription
FT                   regulator; PFAM: regulatory protein LacI; periplasmic
FT                   binding protein/LacI transcriptional regulator; SMART:
FT                   regulatory protein LacI"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50292"
FT                   /db_xref="GOA:D9SR04"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR04"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ADL50292.1"
FT                   /translation="MESITIKDIAKICGVGVSTVSRAINNHPDINKETKAMIMDVIKQH
FT                   NYIPNNSARNLKRLDSNAIAVLIKGISNPFFSNMIKIFEREIKEKKYSFILQHVDDKED
FT                   EIDVAIELIKEKKLKGIVFLGGHFSHPIEKLEQLKVPFVLSTIGTTQKLDKTICSSVSV
FT                   DDFEESYKMVNYLCSLGHTKIATITAPMDDESIGNLRYNGYISALKNNGIEIQENLIRI
FT                   MKAELYSYSMENGYAVTKELLESGEDFTAIYAISDSIAIGACKAIFDSGKRVPEDYSVV
FT                   GFDGLDIAHYYNPSITTIRQPVEEMAEATIKILFDVIRKKKSAQHRTFQGELVIGNSVK
FT                   SLK"
     MESITIKDIA KICGVGVSTV SRAINNHPDI NKETKAMIMD VIKQHNYIPN NSARNLKRLD        60
     SNAIAVLIKG ISNPFFSNMI KIFEREIKEK KYSFILQHVD DKEDEIDVAI ELIKEKKLKG       120
     IVFLGGHFSH PIEKLEQLKV PFVLSTIGTT QKLDKTICSS VSVDDFEESY KMVNYLCSLG       180
     HTKIATITAP MDDESIGNLR YNGYISALKN NGIEIQENLI RIMKAELYSY SMENGYAVTK       240
     ELLESGEDFT AIYAISDSIA IGACKAIFDS GKRVPEDYSV VGFDGLDIAH YYNPSITTIR       300
     QPVEEMAEAT IKILFDVIRK KKSAQHRTFQ GELVIGNSVK SLK                         343
//

If you have problems or comments...

PBIL Back to PBIL home page