(data stored in ACNUC7421 zone)

EMBL: CP002160.PE505

CP002160.PE505       Location/Qualifiers
FT   CDS             645487..646530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0521"
FT                   /product="sulfate ABC transporter, periplasmic
FT                   sulfate-binding protein"
FT                   /note="KEGG: ckr:CKR_1675 hypothetical protein; TIGRFAM:
FT                   sulfate ABC transporter, periplasmic sulfate-binding
FT                   protein; PFAM: extracellular solute-binding protein family
FT                   1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50296"
FT                   /db_xref="GOA:D9SR08"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR034408"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR08"
FT                   /inference="protein motif:TFAM:TIGR00971"
FT                   /protein_id="ADL50296.1"
FT                   /translation="MRKNRFLSIALSAILLGAILTGCGSSSSGSDKQNSSSGVELLNVS
FT                   YDPTREFYTEYNRAFIKYWGEKTGQDITINQSHGGSGKQGRSVIEGLEGDVVTLALAYD
FT                   IDEISNAGLINKDWQGEFQNNSTPYTSTIVFLVRKGNPKGIKDWDDLVKEGVSVITPNP
FT                   KTSGGARWNYLAAWAYALNKNNGSEDDAKSFVGDLYKNVEVLDSGARGATTTFVERGIG
FT                   DVLIAWENEAYLSLNELGSDKFEIVVPSISILAEPPVAIVDEVAEKKGTTEVAKAYLEY
FT                   LYSDEGQEIIAKNYYRPRNSKIAEKYKNTFKDVKLFTVDDTFGGWTKAQATHFADGGVF
FT                   DEIYSPK"
     MRKNRFLSIA LSAILLGAIL TGCGSSSSGS DKQNSSSGVE LLNVSYDPTR EFYTEYNRAF        60
     IKYWGEKTGQ DITINQSHGG SGKQGRSVIE GLEGDVVTLA LAYDIDEISN AGLINKDWQG       120
     EFQNNSTPYT STIVFLVRKG NPKGIKDWDD LVKEGVSVIT PNPKTSGGAR WNYLAAWAYA       180
     LNKNNGSEDD AKSFVGDLYK NVEVLDSGAR GATTTFVERG IGDVLIAWEN EAYLSLNELG       240
     SDKFEIVVPS ISILAEPPVA IVDEVAEKKG TTEVAKAYLE YLYSDEGQEI IAKNYYRPRN       300
     SKIAEKYKNT FKDVKLFTVD DTFGGWTKAQ ATHFADGGVF DEIYSPK                     347
//

If you have problems or comments...

PBIL Back to PBIL home page