(data stored in ACNUC7421 zone)

EMBL: CP002160.PE506

CP002160.PE506       Location/Qualifiers
FT   CDS             646558..647382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0522"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysT"
FT                   /note="KEGG: cbe:Cbei_4192 sulfate ABC transporter, inner
FT                   membrane subunit CysT; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysT; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50297"
FT                   /db_xref="GOA:D9SR09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR09"
FT                   /inference="protein motif:TFAM:TIGR02139"
FT                   /protein_id="ADL50297.1"
FT                   /translation="MKKQKRVIPGFGLSLGVTLTFLSLIVLIPIASVIIKGTDMGFGGF
FT                   LKIVFDERVLASYKVSMLSALVAALINSVFGLILAWVLVRYNFPLKRIMDGVIDLPFAL
FT                   PTAVAGIALTTLYSQNGLLGSFFYKFGIKIAFTPLGIIIAMTFIGIPFVVRTVQPVLEE
FT                   LDFQFEEAARMLGASRRTTFFKVIFPEVFPALLTGFGLAFARALGEYGSVVFISGNKPM
FT                   KTEIPPFLIMSKLEQYDYSGATAIAIVMLLISFLVLFLMNVVQVRANKFSKS"
     MKKQKRVIPG FGLSLGVTLT FLSLIVLIPI ASVIIKGTDM GFGGFLKIVF DERVLASYKV        60
     SMLSALVAAL INSVFGLILA WVLVRYNFPL KRIMDGVIDL PFALPTAVAG IALTTLYSQN       120
     GLLGSFFYKF GIKIAFTPLG IIIAMTFIGI PFVVRTVQPV LEELDFQFEE AARMLGASRR       180
     TTFFKVIFPE VFPALLTGFG LAFARALGEY GSVVFISGNK PMKTEIPPFL IMSKLEQYDY       240
     SGATAIAIVM LLISFLVLFL MNVVQVRANK FSKS                                   274
//

If you have problems or comments...

PBIL Back to PBIL home page