(data stored in ACNUC7421 zone)

EMBL: CP002160.PE507

CP002160.PE507       Location/Qualifiers
FT   CDS             647393..648220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0523"
FT                   /product="sulfate ABC transporter, inner membrane subunit
FT                   CysW"
FT                   /note="KEGG: cbe:Cbei_4191 sulfate ABC transporter, inner
FT                   membrane subunit CysW; TIGRFAM: sulfate ABC transporter,
FT                   inner membrane subunit CysW; sulfate ABC transporter, inner
FT                   membrane subunit; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50298"
FT                   /db_xref="GOA:D9SR10"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR10"
FT                   /inference="protein motif:TFAM:TIGR02140"
FT                   /protein_id="ADL50298.1"
FT                   /translation="MKKELKTENTITKWILIFISVAFLILMLGFPLAVVMIEALKKGFG
FT                   AYVKAITDNYTLKAVSLTLLATLVATIVNTIFGIFAAWAITKFKFKNKNILTTLIDIPF
FT                   AISPVIAGLIFILTFGRIGWLNGLLSAIDAKIVFAIPGIILATIFVTFPFVSREIIPLM
FT                   NSQGTDEEEAAAMMGASGFKIFTKITLPNIKWGLIYGIILCTARAMGEFGAVSVVSGHI
FT                   RGKTNTLPLHVEILYNEYQFSAAFAVSSLLVIIAIVVLILRNIVEWKAKKGDL"
     MKKELKTENT ITKWILIFIS VAFLILMLGF PLAVVMIEAL KKGFGAYVKA ITDNYTLKAV        60
     SLTLLATLVA TIVNTIFGIF AAWAITKFKF KNKNILTTLI DIPFAISPVI AGLIFILTFG       120
     RIGWLNGLLS AIDAKIVFAI PGIILATIFV TFPFVSREII PLMNSQGTDE EEAAAMMGAS       180
     GFKIFTKITL PNIKWGLIYG IILCTARAMG EFGAVSVVSG HIRGKTNTLP LHVEILYNEY       240
     QFSAAFAVSS LLVIIAIVVL ILRNIVEWKA KKGDL                                  275
//

If you have problems or comments...

PBIL Back to PBIL home page