(data stored in ACNUC7421 zone)

EMBL: CP002160.PE509

CP002160.PE509       Location/Qualifiers
FT   CDS             649410..651086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0525"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: cbe:Cbei_4189
FT                   adenylylsulfate reductase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50300"
FT                   /db_xref="GOA:D9SR12"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR12"
FT                   /inference="protein motif:PFAM:PF02910"
FT                   /protein_id="ADL50300.1"
FT                   /translation="MKINKLSTDILIIGGGTAGCYAAITISESSDAKVIIAEKANIKRS
FT                   GCLAAGVNAINAYIVKGNKPEDYVDYAKKDADNIVREDLLLTMAERLNDVTKKLEDLGL
FT                   VILKDENGQYVARGNRNIKINGENIKPILADAVNKLHNVAVINKINIIDFILEDGKVVG
FT                   AYGIGVNEEVFYVIEAKAVICATGGASGLYRPNNPGFSRHKMWYSPFNTGAGYAMGIRA
FT                   GAEMTTFEMRFIALRCKDTIAPTGTIAQGVGAKQVNSLGEEYESKYGITTSQRVYGTVQ
FT                   ENLAGRGPCYLKTEGISAVQDDQLLKAYLNMAPSQTLKWIEENKKPSEQNVEIEGTEPY
FT                   IVGGHTASGYWIDTKRATTIKGLYAAGDVAGGCPQKYVTGALVEGEIAANSALEYINGY
FT                   EKIEIKENIIDKRFNEVTAMFSKEDSIYDVEKLEDAMQKVMDNYAGGIKTNYQYNEKQL
FT                   NLADEKIDNIIRLSEGIKAKDIDDLVQIFELKDRLVVCKSVIAHLRARKETRWHSFAEN
FT                   LDYPEKDDSWLKYVNSKVVDGNLEIIYRDLVYRGEIYEHID"
     MKINKLSTDI LIIGGGTAGC YAAITISESS DAKVIIAEKA NIKRSGCLAA GVNAINAYIV        60
     KGNKPEDYVD YAKKDADNIV REDLLLTMAE RLNDVTKKLE DLGLVILKDE NGQYVARGNR       120
     NIKINGENIK PILADAVNKL HNVAVINKIN IIDFILEDGK VVGAYGIGVN EEVFYVIEAK       180
     AVICATGGAS GLYRPNNPGF SRHKMWYSPF NTGAGYAMGI RAGAEMTTFE MRFIALRCKD       240
     TIAPTGTIAQ GVGAKQVNSL GEEYESKYGI TTSQRVYGTV QENLAGRGPC YLKTEGISAV       300
     QDDQLLKAYL NMAPSQTLKW IEENKKPSEQ NVEIEGTEPY IVGGHTASGY WIDTKRATTI       360
     KGLYAAGDVA GGCPQKYVTG ALVEGEIAAN SALEYINGYE KIEIKENIID KRFNEVTAMF       420
     SKEDSIYDVE KLEDAMQKVM DNYAGGIKTN YQYNEKQLNL ADEKIDNIIR LSEGIKAKDI       480
     DDLVQIFELK DRLVVCKSVI AHLRARKETR WHSFAENLDY PEKDDSWLKY VNSKVVDGNL       540
     EIIYRDLVYR GEIYEHID                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page