(data stored in ACNUC7421 zone)

EMBL: CP002160.PE510

CP002160.PE510       Location/Qualifiers
FT   CDS             651070..651384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0526"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="KEGG: fsu:Fisuc_0145 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50301"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR13"
FT                   /inference="similar to AA sequence:KEGG:Fisuc_0145"
FT                   /protein_id="ADL50301.1"
FT                   /translation="MSISIDKSLCVGCKQCSEVCPGNLIRIDENNKAFIKYPKDCWGCV
FT                   SCVKECKVNAIKFYLGADIGGRGSLAYTKEEKDITHWVIEEKYGTVKTIDVNKKSANAY
FT                   "
     MSISIDKSLC VGCKQCSEVC PGNLIRIDEN NKAFIKYPKD CWGCVSCVKE CKVNAIKFYL        60
     GADIGGRGSL AYTKEEKDIT HWVIEEKYGT VKTIDVNKKS ANAY                        104
//

If you have problems or comments...

PBIL Back to PBIL home page