(data stored in ACNUC7421 zone)

EMBL: CP002160.PE511

CP002160.PE511       Location/Qualifiers
FT   CDS             651458..652258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0527"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /note="PFAM: phosphoadenosine phosphosulfate reductase;
FT                   KEGG: csc:Csac_1642 sulfate adenylyltransferase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50302"
FT                   /db_xref="GOA:D9SR14"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR14"
FT                   /inference="protein motif:PFAM:PF01507"
FT                   /protein_id="ADL50302.1"
FT                   /translation="MDHLDLLEAQSIFILREAYKKLGKLGMLWSIGKDSTVLLWLAKKA
FT                   FYGHCPFPFIHVDTTYKIPEMIQYRDRVAKELNLDLIVHTNKEAIEAGMGPDQGRLVCC
FT                   KALKTEALQDVVRVYGFEGLIVGVRRDEEGSRSKERVFSERNKEYEWDYSNQPPELWDQ
FT                   FKTDFPKGNHIRVHPLLHWNELDIWEYIKRENIPIIDLYFSKNGERYRSLGCAPCTGRI
FT                   KSEAKNLDEIIEELRHTTTGERAGRAQDQEDSYAMQKLRKDGYM"
     MDHLDLLEAQ SIFILREAYK KLGKLGMLWS IGKDSTVLLW LAKKAFYGHC PFPFIHVDTT        60
     YKIPEMIQYR DRVAKELNLD LIVHTNKEAI EAGMGPDQGR LVCCKALKTE ALQDVVRVYG       120
     FEGLIVGVRR DEEGSRSKER VFSERNKEYE WDYSNQPPEL WDQFKTDFPK GNHIRVHPLL       180
     HWNELDIWEY IKRENIPIID LYFSKNGERY RSLGCAPCTG RIKSEAKNLD EIIEELRHTT       240
     TGERAGRAQD QEDSYAMQKL RKDGYM                                            266
//

If you have problems or comments...

PBIL Back to PBIL home page