(data stored in ACNUC7421 zone)

EMBL: CP002160.PE513

CP002160.PE513       Location/Qualifiers
FT   CDS             654190..654621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0529"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="KEGG: cce:Ccel_1609 transcriptional regulator, MarR
FT                   family; PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50304"
FT                   /db_xref="GOA:D9SR16"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR16"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ADL50304.1"
FT                   /translation="MNNQGSGYLRELIRILARHLGVLEKEDSNCSGVTTSQCHAIVEVG
FT                   RAGEISLNELADILTLDKSTMSRTINNLVDKKLVIREIDPTDRRYVMIKLTDEGMKIFN
FT                   DIESSMNQYYGIVFNNLPENKREQVLESLNLLIDAVDKK"
     MNNQGSGYLR ELIRILARHL GVLEKEDSNC SGVTTSQCHA IVEVGRAGEI SLNELADILT        60
     LDKSTMSRTI NNLVDKKLVI REIDPTDRRY VMIKLTDEGM KIFNDIESSM NQYYGIVFNN       120
     LPENKREQVL ESLNLLIDAV DKK                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page