(data stored in ACNUC7421 zone)

EMBL: CP002160.PE514

CP002160.PE514       Location/Qualifiers
FT   CDS             654780..655280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0530"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   bpf:BpOF4_18205 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50305"
FT                   /db_xref="GOA:D9SR17"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR17"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ADL50305.1"
FT                   /translation="MNYTIENIVQEDWESIANIYLEGISTGKATFQTDVPTWEQWDSSH
FT                   TRTCRLVARLDDKILGWSALSPTSSRCVYAGVAEVSIYIGKEFRGQGIGTSLLNRLISL
FT                   SEENGFWTLQSGIIRENVESIELHKNCGFREIGVREKLGKMSNGKWHDVVLMERRSKIT
FT                   GIS"
     MNYTIENIVQ EDWESIANIY LEGISTGKAT FQTDVPTWEQ WDSSHTRTCR LVARLDDKIL        60
     GWSALSPTSS RCVYAGVAEV SIYIGKEFRG QGIGTSLLNR LISLSEENGF WTLQSGIIRE       120
     NVESIELHKN CGFREIGVRE KLGKMSNGKW HDVVLMERRS KITGIS                      166
//

If you have problems or comments...

PBIL Back to PBIL home page