(data stored in ACNUC7421 zone)

EMBL: CP002160.PE515

CP002160.PE515       Location/Qualifiers
FT   CDS             655340..656242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0531"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: cbe:Cbei_4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50306"
FT                   /db_xref="GOA:D9SR18"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR18"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ADL50306.1"
FT                   /translation="MDNKRKALPYLTAFMSSIIFGLSFLFTKRALDVSSPITLVAFRFL
FT                   IATIVMTALILFKVIKVNYKNKPLGWLFLLAMFEPVIYFIFETYGLQYTASSIGGLMIS
FT                   LIPIAVTILGVYFLKEKPTVKQVIFILTSVSGVALIGIMGSSGDTNNSLLGILLMFGAV
FT                   MSAAFFTIISRKISNQFNAIEITYFMMITGAVCFNVISLFEHIINKNLSAYLEPLKSTT
FT                   FLSSVFYLGILSSIIAYFLINFSLSKLEASKTTVFSNISTIVSIFAGVIFLRESFHLYH
FT                   AVGSVLILLGVWGTSHYSR"
     MDNKRKALPY LTAFMSSIIF GLSFLFTKRA LDVSSPITLV AFRFLIATIV MTALILFKVI        60
     KVNYKNKPLG WLFLLAMFEP VIYFIFETYG LQYTASSIGG LMISLIPIAV TILGVYFLKE       120
     KPTVKQVIFI LTSVSGVALI GIMGSSGDTN NSLLGILLMF GAVMSAAFFT IISRKISNQF       180
     NAIEITYFMM ITGAVCFNVI SLFEHIINKN LSAYLEPLKS TTFLSSVFYL GILSSIIAYF       240
     LINFSLSKLE ASKTTVFSNI STIVSIFAGV IFLRESFHLY HAVGSVLILL GVWGTSHYSR       300
//

If you have problems or comments...

PBIL Back to PBIL home page