(data stored in ACNUC7421 zone)

EMBL: CP002160.PE518

CP002160.PE518       Location/Qualifiers
FT   CDS             659742..660278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0534"
FT                   /product="protein of unknown function DUF1234"
FT                   /note="PFAM: protein of unknown function DUF1234; KEGG:
FT                   cbe:Cbei_3510 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50309"
FT                   /db_xref="GOA:D9SR21"
FT                   /db_xref="InterPro:IPR010662"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR21"
FT                   /inference="protein motif:PFAM:PF06821"
FT                   /protein_id="ADL50309.1"
FT                   /translation="MKVKILPGLNNSGADHWQSIWEKKYGFERVQQDDWKQPKYNEWEK
FT                   NLIDNLQRENDKNIILIAHSLGCLLTAKAITKIEDYVKAIFLVAPPDTSRDIFPKEINS
FT                   FNNLPNKTLGVPGILVYSEDDQYASAEYSLKQAKNWGLQAVSVGKRGHINSDSNIENWD
FT                   QGYEIFQKLLINEER"
     MKVKILPGLN NSGADHWQSI WEKKYGFERV QQDDWKQPKY NEWEKNLIDN LQRENDKNII        60
     LIAHSLGCLL TAKAITKIED YVKAIFLVAP PDTSRDIFPK EINSFNNLPN KTLGVPGILV       120
     YSEDDQYASA EYSLKQAKNW GLQAVSVGKR GHINSDSNIE NWDQGYEIFQ KLLINEER         178
//

If you have problems or comments...

PBIL Back to PBIL home page