(data stored in ACNUC7421 zone)

EMBL: CP002160.PE52

CP002160.PE52        Location/Qualifiers
FT   CDS             91992..92198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0054"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ere:EUBREC_1196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49843"
FT                   /db_xref="GOA:D9SMQ8"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMQ8"
FT                   /inference="similar to AA sequence:KEGG:EUBREC_1196"
FT                   /protein_id="ADL49843.1"
FT                   /translation="MELLAGIFLVIIGFKMLIKPKGIWRISESWKNKRNVEPTILYIRA
FT                   LQILGCILVVLGVTEIIDFIEGI"
     MELLAGIFLV IIGFKMLIKP KGIWRISESW KNKRNVEPTI LYIRALQILG CILVVLGVTE        60
     IIDFIEGI                                                                 68
//

If you have problems or comments...

PBIL Back to PBIL home page