(data stored in ACNUC7421 zone)

EMBL: CP002160.PE522

CP002160.PE522       Location/Qualifiers
FT   CDS             complement(664408..665013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0540"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: cbl:CLK_1643
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50313"
FT                   /db_xref="GOA:D9SR25"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR25"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ADL50313.1"
FT                   /translation="MSKDFYIILKERRSFYGIGKETTISTEHIEEIIENALQYTPSAFN
FT                   TPSSRIVLLFGEDHNKLWDITKKEFQEIVPLDQFPSVEEKINSFRNGYGTVLFFEDINV
FT                   IEQLQRNYDLYHDNFPVWAHQASGMLQYIVWSSLEIEGLGASLQHYNPIIDREVKNHWR
FT                   LPSNWKLIAQMPFGKPISVPDKREFTSINERLKVFKSY"
     MSKDFYIILK ERRSFYGIGK ETTISTEHIE EIIENALQYT PSAFNTPSSR IVLLFGEDHN        60
     KLWDITKKEF QEIVPLDQFP SVEEKINSFR NGYGTVLFFE DINVIEQLQR NYDLYHDNFP       120
     VWAHQASGML QYIVWSSLEI EGLGASLQHY NPIIDREVKN HWRLPSNWKL IAQMPFGKPI       180
     SVPDKREFTS INERLKVFKS Y                                                 201
//

If you have problems or comments...

PBIL Back to PBIL home page