(data stored in ACNUC7421 zone)

EMBL: CP002160.PE525

CP002160.PE525       Location/Qualifiers
FT   CDS             complement(670461..671756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0543"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cpy:Cphy_2885 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50316"
FT                   /db_xref="GOA:D9SR28"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR28"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADL50316.1"
FT                   /translation="MKFHYKRTVFVGLAFLSICAFWQMYDSIIPLILKNTFGIGDTLSG
FT                   LIMALDNILAIFLLPFFGALSDRCNAKIGRRTPFIVIGTLLSIVFMFLIPTADNIVSLP
FT                   LFIIALGLVLLSMGIYRSPAVALMPDITPNQLRSKANAIINLMGAIGGILTLIIIKIFV
FT                   KPISKPNYFYTFIAIALVMIISIVILLITIKERKIVSELEASNYGNPKDIQNKNALEEN
FT                   KIKEPMQPEVKRSLYFLLFSVFLWFMGYNAVSTAFTKYAQEAWSMDIGTAATYLLVATI
FT                   VTILAYVPIGIISSKFGRKKLITFGIILVSISFFLGSLFKNYSPLLNIIFALIGIGWAS
FT                   INVNSYPMVVEISNLHDVGKYTGLYYTFSMSAQIITPILSGALLEYMGYRTLFPYATIF
FT                   IILSFFTMLLVKHGDNKPQLPKDKLGFFSTED"
     MKFHYKRTVF VGLAFLSICA FWQMYDSIIP LILKNTFGIG DTLSGLIMAL DNILAIFLLP        60
     FFGALSDRCN AKIGRRTPFI VIGTLLSIVF MFLIPTADNI VSLPLFIIAL GLVLLSMGIY       120
     RSPAVALMPD ITPNQLRSKA NAIINLMGAI GGILTLIIIK IFVKPISKPN YFYTFIAIAL       180
     VMIISIVILL ITIKERKIVS ELEASNYGNP KDIQNKNALE ENKIKEPMQP EVKRSLYFLL       240
     FSVFLWFMGY NAVSTAFTKY AQEAWSMDIG TAATYLLVAT IVTILAYVPI GIISSKFGRK       300
     KLITFGIILV SISFFLGSLF KNYSPLLNII FALIGIGWAS INVNSYPMVV EISNLHDVGK       360
     YTGLYYTFSM SAQIITPILS GALLEYMGYR TLFPYATIFI ILSFFTMLLV KHGDNKPQLP       420
     KDKLGFFSTE D                                                            431
//

If you have problems or comments...

PBIL Back to PBIL home page