(data stored in ACNUC7421 zone)

EMBL: CP002160.PE526

CP002160.PE526       Location/Qualifiers
FT   CDS             671991..672509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0544"
FT                   /product="membrane spanning protein"
FT                   /note="KEGG: cbe:Cbei_0760 membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50317"
FT                   /db_xref="GOA:D9SR29"
FT                   /db_xref="InterPro:IPR009825"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR29"
FT                   /inference="similar to AA sequence:KEGG:Cbei_0760"
FT                   /protein_id="ADL50317.1"
FT                   /translation="MEKSRTQKMILSALFIAMIFVATRINIKLPLGNGGLVHLGTAFLF
FT                   IIAVNFGTRYGAISGALGMTIFDVLSGWAAWAPTTFVARLVMGYIVGKMNEKREKGNIL
FT                   IMLASFVISGVFMIAIYYIGNAITFGNWIAPIQSIPGDITQIVIGALIALPATKAIERI
FT                   NILKRYRWD"
     MEKSRTQKMI LSALFIAMIF VATRINIKLP LGNGGLVHLG TAFLFIIAVN FGTRYGAISG        60
     ALGMTIFDVL SGWAAWAPTT FVARLVMGYI VGKMNEKREK GNILIMLASF VISGVFMIAI       120
     YYIGNAITFG NWIAPIQSIP GDITQIVIGA LIALPATKAI ERINILKRYR WD               172
//

If you have problems or comments...

PBIL Back to PBIL home page