(data stored in ACNUC7421 zone)

EMBL: CP002160.PE528

CP002160.PE528       Location/Qualifiers
FT   CDS             673933..676011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0546"
FT                   /product="Lecithin:cholesterol acyltransferase"
FT                   /note="PFAM: Lecithin:cholesterol acyltransferase; type 3a
FT                   cellulose-binding domain protein; KEGG: mla:Mlab_0281
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50319"
FT                   /db_xref="GOA:D9SR31"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR31"
FT                   /inference="protein motif:PFAM:PF02450"
FT                   /protein_id="ADL50319.1"
FT                   /translation="MKKKVCLLTLVFAIAITNLFSTIASAAGATTKRQAVLVIPGIMGS
FT                   NLVDSDGDTVWVTDEWIAGSKQLYYLLNGTISCTSSGFSSETIIPKLGTNEYGAKDTYK
FT                   DLVNRLKGEFQNDYDVIFAAYDWRVDNTRSAMELKKTIDNYDNVIIVAHSMGGLVTSRY
FT                   LQMYGGSKVDKVITLGTPYWGAVSAAETMYTGEVSVLPDIVRGAMSGTMRDLVTNYPSM
FT                   HQLLPNTYYTNKSNWLTTEKRVYEKWYDYVWPRTKDILNNTADTQQFYKDNFNSSLVTV
FT                   ATNFHNSLYSSTAPIKLVDNTVIVGNGVNTVTSVKLATNSILGIKSRLSVPKYTTSGDG
FT                   TVPFLSATIGNGVNYIQRNGIDHTGLVKDPTTLTMVVDSIRGAIASKASVVRSAVSAQG
FT                   SPIDYKLTFAGDLNFQAIKDNTVVSSIDKLPMEDQNYYNVKDAKEVKIDNIGTVGEDNA
FT                   YLATFTQAGYTFKFKSNKDQKIDFAVGPNNLIFGFDNINLNEGADVYVNMTSQENISAA
FT                   IDNNADGVVDSVVNPTIKDLSEDITANDLVVYSSDRNAYNKLDNSLYPQMKVKNVSNKT
FT                   INLSDLELRYFFNNDGNDNNKFECDWAGLNNGTINASVKSDFVSNENGDTMLTIGFVND
FT                   GKVLMPGQEIEVQGRIHNDKWSIYNKSNDYSFSGQAYTVNSKVVLYAKDLLIFGVTP"
     MKKKVCLLTL VFAIAITNLF STIASAAGAT TKRQAVLVIP GIMGSNLVDS DGDTVWVTDE        60
     WIAGSKQLYY LLNGTISCTS SGFSSETIIP KLGTNEYGAK DTYKDLVNRL KGEFQNDYDV       120
     IFAAYDWRVD NTRSAMELKK TIDNYDNVII VAHSMGGLVT SRYLQMYGGS KVDKVITLGT       180
     PYWGAVSAAE TMYTGEVSVL PDIVRGAMSG TMRDLVTNYP SMHQLLPNTY YTNKSNWLTT       240
     EKRVYEKWYD YVWPRTKDIL NNTADTQQFY KDNFNSSLVT VATNFHNSLY SSTAPIKLVD       300
     NTVIVGNGVN TVTSVKLATN SILGIKSRLS VPKYTTSGDG TVPFLSATIG NGVNYIQRNG       360
     IDHTGLVKDP TTLTMVVDSI RGAIASKASV VRSAVSAQGS PIDYKLTFAG DLNFQAIKDN       420
     TVVSSIDKLP MEDQNYYNVK DAKEVKIDNI GTVGEDNAYL ATFTQAGYTF KFKSNKDQKI       480
     DFAVGPNNLI FGFDNINLNE GADVYVNMTS QENISAAIDN NADGVVDSVV NPTIKDLSED       540
     ITANDLVVYS SDRNAYNKLD NSLYPQMKVK NVSNKTINLS DLELRYFFNN DGNDNNKFEC       600
     DWAGLNNGTI NASVKSDFVS NENGDTMLTI GFVNDGKVLM PGQEIEVQGR IHNDKWSIYN       660
     KSNDYSFSGQ AYTVNSKVVL YAKDLLIFGV TP                                     692
//

If you have problems or comments...

PBIL Back to PBIL home page