(data stored in ACNUC7421 zone)

EMBL: CP002160.PE530

CP002160.PE530       Location/Qualifiers
FT   CDS             678518..679777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0548"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tit:Thit_1738 extracellular solute-binding protein
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50321"
FT                   /db_xref="GOA:D9SR33"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR33"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADL50321.1"
FT                   /translation="MYKKLMTLIVIFVFVFSFSGCGNEKVNSTKQQETVTIKFSWWGTD
FT                   TRHEATMSAVKKFQEKYPNIKVKMEFGEWTGFQKKMAVYIAGNTEPDVMQINYDWLQLY
FT                   SKDGAGFYDLNKVSDIFNLQNFNEKILSYGSKNNIVNGVPLASNVKGLYYNKTTFDKFG
FT                   VPIPKTWDDLFKAAEKFGEGYYPLELDSRGGWNLAATYVQQKTGKDFIKVDGTIGFSER
FT                   DIKDLLTFYKSLLDKKVIPNLQGKKISNFDEGKYAGTYQWISNSEKYAKKLKDKNQELI
FT                   AGDLPVIDDAVNSGWYVKPSSLFAISKNTEHPKEAAMLLEYLVNDTEGIVAMGTDRGLS
FT                   VSNAAKEYLNTLDKTVQFDATEKLNAIKPVLMNPYFENTLIQNICEASIEEITYDKSTI
FT                   DECAKNTYAKLVTTLSVVAK"
     MYKKLMTLIV IFVFVFSFSG CGNEKVNSTK QQETVTIKFS WWGTDTRHEA TMSAVKKFQE        60
     KYPNIKVKME FGEWTGFQKK MAVYIAGNTE PDVMQINYDW LQLYSKDGAG FYDLNKVSDI       120
     FNLQNFNEKI LSYGSKNNIV NGVPLASNVK GLYYNKTTFD KFGVPIPKTW DDLFKAAEKF       180
     GEGYYPLELD SRGGWNLAAT YVQQKTGKDF IKVDGTIGFS ERDIKDLLTF YKSLLDKKVI       240
     PNLQGKKISN FDEGKYAGTY QWISNSEKYA KKLKDKNQEL IAGDLPVIDD AVNSGWYVKP       300
     SSLFAISKNT EHPKEAAMLL EYLVNDTEGI VAMGTDRGLS VSNAAKEYLN TLDKTVQFDA       360
     TEKLNAIKPV LMNPYFENTL IQNICEASIE EITYDKSTID ECAKNTYAKL VTTLSVVAK        419
//

If you have problems or comments...

PBIL Back to PBIL home page