(data stored in ACNUC7421 zone)

EMBL: CP002160.PE533

CP002160.PE533       Location/Qualifiers
FT   CDS             complement(680578..680760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0551"
FT                   /product="Bacteriocin class II, amylovorin-like"
FT                   /note="PFAM: Bacteriocin class II, amylovorin-like; KEGG:
FT                   rha:RHA1_ro09148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50324"
FT                   /db_xref="GOA:D9SR36"
FT                   /db_xref="InterPro:IPR019493"
FT                   /db_xref="InterPro:IPR023991"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR36"
FT                   /inference="protein motif:PFAM:PF10439"
FT                   /protein_id="ADL50324.1"
FT                   /translation="MENFKTLSEVELHQIDGGKWKWKKIIKIAAAVAGTVVTIASGGAA
FT                   APAVIGGAIAVANEL"
     MENFKTLSEV ELHQIDGGKW KWKKIIKIAA AVAGTVVTIA SGGAAAPAVI GGAIAVANEL        60
//

If you have problems or comments...

PBIL Back to PBIL home page