(data stored in ACNUC7421 zone)

EMBL: CP002160.PE534

CP002160.PE534       Location/Qualifiers
FT   CDS             681073..681792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0552"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: edi:EDI_341030 intracellular protein transport
FT                   protein USO1"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50325"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR37"
FT                   /inference="similar to AA sequence:KEGG:EDI_341030"
FT                   /protein_id="ADL50325.1"
FT                   /translation="MNKILRVIAGVSVAACVLSGCGNDSDSSKKVESSKETSSTTENVN
FT                   NDNKNSAESTKDKNEGLPVVDDSVVREFKQDTPENAIREFYANVSSLNEKEYATFYQVP
FT                   DGYKTIKYSWECYGIEKIDVTKVEVDYNDSVPNDPIALATVQYNQKLKDIEEPLSTFTM
FT                   IELRKVNEKWVIAAQESLTQAQDQWVVKLREEKMNTDEYKKLLESSRKFQEKNSEFMSK
FT                   AAQELNKYLTGQDGTSR"
     MNKILRVIAG VSVAACVLSG CGNDSDSSKK VESSKETSST TENVNNDNKN SAESTKDKNE        60
     GLPVVDDSVV REFKQDTPEN AIREFYANVS SLNEKEYATF YQVPDGYKTI KYSWECYGIE       120
     KIDVTKVEVD YNDSVPNDPI ALATVQYNQK LKDIEEPLST FTMIELRKVN EKWVIAAQES       180
     LTQAQDQWVV KLREEKMNTD EYKKLLESSR KFQEKNSEFM SKAAQELNKY LTGQDGTSR        239
//

If you have problems or comments...

PBIL Back to PBIL home page