(data stored in ACNUC7421 zone)

EMBL: CP002160.PE538

CP002160.PE538       Location/Qualifiers
FT   CDS             complement(684749..685435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0556"
FT                   /product="capsular exopolysaccharide family"
FT                   /EC_number="2.7.10.2"
FT                   /note="KEGG: cno:NT01CX_1523 capsular polysaccharide
FT                   biosynthesis protein Cap1B; TIGRFAM: capsular
FT                   exopolysaccharide family"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50329"
FT                   /db_xref="GOA:D9SR41"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR41"
FT                   /inference="protein motif:TFAM:TIGR01007"
FT                   /protein_id="ADL50329.1"
FT                   /translation="MLKSLVTHLDPKSVISETYRTLRTNIQYANIDGDLRSIIITSSSP
FT                   SEGKSTTVANLAIATAQTGKKILIIDADLRKPSVHKKFGISNQLGLTNVLTEQCEIFSA
FT                   IQKSEVRNLYILASGPIPPNPSELLGSKKMQNLLDLLKSKFDMVIIDTPPVLAVTDSQI
FT                   LSTEVDGVILVAVYGKTDKKALIKAKERLDKVDANLLGSILTRVPANSKNGSSYYYYYY
FT                   GEKKAK"
     MLKSLVTHLD PKSVISETYR TLRTNIQYAN IDGDLRSIII TSSSPSEGKS TTVANLAIAT        60
     AQTGKKILII DADLRKPSVH KKFGISNQLG LTNVLTEQCE IFSAIQKSEV RNLYILASGP       120
     IPPNPSELLG SKKMQNLLDL LKSKFDMVII DTPPVLAVTD SQILSTEVDG VILVAVYGKT       180
     DKKALIKAKE RLDKVDANLL GSILTRVPAN SKNGSSYYYY YYGEKKAK                    228
//

If you have problems or comments...

PBIL Back to PBIL home page