(data stored in ACNUC7421 zone)

EMBL: CP002160.PE539

CP002160.PE539       Location/Qualifiers
FT   CDS             complement(685446..686120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0557"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   cno:NT01CX_1522 Cps19aC, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50330"
FT                   /db_xref="GOA:D9SR42"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR42"
FT                   /inference="protein motif:PFAM:PF02706"
FT                   /protein_id="ADL50330.1"
FT                   /translation="MELKEYWYIIKKRLILIISFTLLCGAISGIITTFVIDKIYTADIS
FT                   VLIGKQESSDSEKTSTTYNDILMYQKIVKTYSQIAKSRKVADDVKEKLSLNMSSGALLG
FT                   SMSVSSSTDTEFMTIRFSSKDPELAAKITNQWAASLKEISKKIKGSDNVQILDNALVPS
FT                   SPSSPNVRSNVIMTLFFGFVLSIGLTFLVDYLDNTVKSEDDLSKILDSTVLGSIPDLKF
FT                   EE"
     MELKEYWYII KKRLILIISF TLLCGAISGI ITTFVIDKIY TADISVLIGK QESSDSEKTS        60
     TTYNDILMYQ KIVKTYSQIA KSRKVADDVK EKLSLNMSSG ALLGSMSVSS STDTEFMTIR       120
     FSSKDPELAA KITNQWAASL KEISKKIKGS DNVQILDNAL VPSSPSSPNV RSNVIMTLFF       180
     GFVLSIGLTF LVDYLDNTVK SEDDLSKILD STVLGSIPDL KFEE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page