(data stored in ACNUC7421 zone)

EMBL: CP002160.PE540

CP002160.PE540       Location/Qualifiers
FT   CDS             686486..687535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0558"
FT                   /product="Mannose-1-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.13"
FT                   /note="KEGG: cac:CAC3072 mannose-1-phosphate
FT                   guanylyltransferase; PFAM: Nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50331"
FT                   /db_xref="GOA:D9SR43"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR43"
FT                   /inference="protein motif:PRIAM:2.7.7.13"
FT                   /protein_id="ADL50331.1"
FT                   /translation="MLCALIMAGGKGTRFWPLSTEEKPKQFLKLLGNETMIQMTVNRLK
FT                   KLIPIERIFVVTGEMYLNILKEQLPELPQENIILEPVGRNTAPCIALSAFRIKKHYEDA
FT                   TIAVLPADHLIENIDRFLHSLDIANRFIHEKPEAIVTLGMKPTRPEVGYGYIKCEKNSR
FT                   YIDEIEIRKVQAFVEKPNFIKALEYIQTGEYLWNGGMFIWKSDNILELTKKHLDKTYEI
FT                   LKYIDSQPEGDYLNTLKEMYPQVANISVDYGIMEKSQDIYVIPSEFGWDDIGTWASVER
FT                   YREKDELNNLIDGNIKIINSQNNLIIGSKKPVIVKGLDDIYFIETDDMIIIGKKEEINE
FT                   IKELKNIIE"
     MLCALIMAGG KGTRFWPLST EEKPKQFLKL LGNETMIQMT VNRLKKLIPI ERIFVVTGEM        60
     YLNILKEQLP ELPQENIILE PVGRNTAPCI ALSAFRIKKH YEDATIAVLP ADHLIENIDR       120
     FLHSLDIANR FIHEKPEAIV TLGMKPTRPE VGYGYIKCEK NSRYIDEIEI RKVQAFVEKP       180
     NFIKALEYIQ TGEYLWNGGM FIWKSDNILE LTKKHLDKTY EILKYIDSQP EGDYLNTLKE       240
     MYPQVANISV DYGIMEKSQD IYVIPSEFGW DDIGTWASVE RYREKDELNN LIDGNIKIIN       300
     SQNNLIIGSK KPVIVKGLDD IYFIETDDMI IIGKKEEINE IKELKNIIE                   349
//

If you have problems or comments...

PBIL Back to PBIL home page