(data stored in ACNUC7421 zone)

EMBL: CP002160.PE544

CP002160.PE544       Location/Qualifiers
FT   CDS             693295..703161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0562"
FT                   /product="YD repeat-containing protein"
FT                   /note="PFAM: YD repeat-containing protein; KEGG:
FT                   cth:Cthe_3052 YD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50335"
FT                   /db_xref="GOA:D9SR47"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR47"
FT                   /inference="protein motif:PFAM:PF05593"
FT                   /protein_id="ADL50335.1"
FT                   /translation="MKKFKRFIAFFLIFSIIFTQNQQILVDTFKNVDLDINLGVLSNIT
FT                   LPTIPTSEKTTTTQNRDIPNLEQMHTLELEELNNLTTENQSITMEKQNLLSFQTPSIIE
FT                   VRSINDSTNLINWTYEEDFEYQLEVDGQIVDLKSVKGYVHNFDSNNKTHIYRIRSKSQE
FT                   QFSQWSEAVTKATEPGKTLTDSVLPIDRNLLKRRIPTATNPIVALTDTISEPSVQYEVH
FT                   VKGAPLSDWQNSKDGRLIVTNGIDAIKVSLLSPPSGLKIKYRVYSENGTWQPWTYDGGI
FT                   CGIYGKNIQMIEMKLEGITTSFSIGYILTNNANQESFPLEMDGETSGTMGTNSGIFLAC
FT                   LVNNNDSKVEVIDKDTTWKKSEGPHIIDGIVRVEPGVTLTIEPGTKVIFQKYKYRENGL
FT                   YINGKVIMEGTPSEKIQFSSMVDGQAVSTDQYYFRGIYVLPTGEIKASYVDMELDRKDN
FT                   YILVNGDVSFNYCNFNCVGDSGIDWNYVIYAKVEREKVLNVSNCTFSNAGQGIGLGDSF
FT                   GEVNITNNSFSNTIRDSIQVGISDYETYSVLANIKANTIVGGKNGISLKGIRSNIVNIK
FT                   VTDNVIKNCSETGVYIEEYLGSLTFQRNTISGVDTNRVKELSGPIVVKVEKLGTNFSSV
FT                   ISAVNPKDVALKNTLSGNNFDAIVLNGTINENSRLFNGTNRYLVRSYLDISKDKTLSIE
FT                   DGTIIHLRGEVVVYGCIRSEGKANNQIVFTSVNSEYTLPYKPTSDPAQKIMDDFFPWIN
FT                   IRNSGSFLGLNTVINRGGGPRKAGGPGYCSINLDGKLTLINSSVFNSTNAGIDAFKDNE
FT                   STEPSDLTIINCSITHNMGHGIWIGHIPATIINSDIHQNDSGIVTFADDTVIAGNSFVG
FT                   NRTSAVNYWNDTKDKYIDLRNNYWGASDGPYATDTGGGAWEGKGQKVNVYPGYAVVYPF
FT                   LKTPSDCVPVGDLNNYVRSVQLRDQKWFGSQGVSVATGNYCKTFMDMEDCFPNLGLSLS
FT                   HTYNSKDETVSILGKGWRLSLQGEISDFSSSAGTAMKKVVLPSGETQTFTVNSNGTFTA
FT                   NDSRNTLTKAGDTFTLTNKEQMQYLFNSSGKLYCVKDKNGNAVNIAYDNGKIDRVYDET
FT                   NKSFKLTYDAATGYIDKITESFGTVTGRIVDFNYDSSKRLSSVTDASGNVTNYVYSGIG
FT                   LLQDTKSGEGALLERIIYTLDGGSYKVRQKIDNYGNSFTYKYDDFVNRTIVTESNGWVK
FT                   EYWCDSYGYPTVTIYPDRSTENKEYYLDASGENKYGEIKASMDIYGNRTEYIRDGRGNV
FT                   TKQINPDESEKNFAYDDKNNLIKEVNEDGNVTYYCYDANKINLIQKVQPLNGTDPLVNP
FT                   LDETKFAITSYEYYSETERVQNGYKVKGSLKTEKTPLGNTTTFKYDANGNKTVVTDGFG
FT                   NNTVYTYDSYNNEASMTTSEGYKTTYVYDMNGRLEKATLHGGEVTRTVYDNEGQKLKEI
FT                   TPNIYDAALDNIDAHTYSGEHGTRFTYYYNGKVATATDAMGNTTRYYYDKYGNVSKEIK
FT                   PNKSVYLYQYDCHNRPIKTTFKESDASTTEILIEEFNYSLSYDRTLESNVLIKSHKQYI
FT                   DNTNTVTSILKFDYANRLVKVKNSDGTEISTKYTPSGLKLIEKDEDSNETLYNYDALGR
FT                   LIKKWTPISENDDVTYYSYSGFQYDKDGNKKVEWTGKNLVEYGVSVSILDPNAIKLTYD
FT                   YYKDGKVQSKVDNEGRRTDYEYSKDRVLTKETVFLTYGGKYEITEYRNNYLGKPIKTLV
FT                   KTAKQDIIGNSITDSALSNMWTTYEYDKNGNLKNVKNYGVVDGTDILSTTPVLNVTSYE
FT                   YDNLNRETKQTKQAKNTAGNDTTIFTSKNYSWDGKVLNSRDGNGRVTTNTYDLRGRLVK
FT                   VRDPKGQYTLFTYDYLGRVLSKTISRLNEDYNSYIQKFNAAINTTPDSPNWDPEYDFNK
FT                   DNVVDLYDNVIINRENIDKTLFEYDDMGRVIREIKSSRNPNTLAWDNVTTKAYKYDNQG
FT                   NVIKELDALGYEQGSGATPAEKIENGYGTEYTYNLLNKQTSVLTPASKDKGLAFNSKYE
FT                   YDGLGRVVKDISANQGSYTYEYNNSGKLTKTTLNKKDGSQLVIKTNQYDLGDNLISEKD
FT                   AKGIETKYEYNLLGKIRKVTTASDATINANTIQYQYDIYGNQALSQESSGRVDLTEYDN
FT                   AGRKIHEKTQKSDGTQVIEKFYFNDGNGNVVAFIDGNGNKTTSTYDEQNKITSKRINVT
FT                   YVDGSTKENRITYEYDIFGQLISETDPLGNVLKYKYDAFGRVIDKRDAYNKVIQILTYN
FT                   ANGSQKESFDALNNEITYIYDKDKRLIKSINGDEATGTIAAEQVYDERNNVIEKRDGNG
FT                   NSTKYQYDELNKLKSVTNALGQVTSYTYDDNGNMETMTDGNGNVTYYEYNCANKPIKIK
FT                   TLKKDITTNVSGNTVDLSTANLSEGYTYYVDGNIKTRTSKNTDVTTYTYDIYGRKLTEV
FT                   IGSINNSYTYDKNDNLLTVKDSTGTTTRTYDALNRTITKDVPNGGTTKYLYDSTNGVDP
FT                   GCYAEVSTDAKGFVTTKIFDKAKRLYKVTESGNTTTYNYYDNGNRQEVIYPNGSKEVYY
FT                   YNKNNTLAKLENKNPNGSIAESFVYEYDNSGNITAKVDKKGKTIYTYDRLNRVETTTEQ
FT                   DGKITTYKYDNAGNRTSMSAVFGSNVETTEYYYDSLNRLRYSHQLLTGIQDSGVALTAE
FT                   KQNSKYDYDENGNQIKVTETSYDSTKQQNVVKETINKYDKLNQLIETTTKDGVVVKNAY
FT                   NAEGYRVAKDVNGVKTNFVYEGDKVVLELDASGNEKGRNIYGENLISRNADGQKVYYLY
FT                   NGHSDVTTLTNEAGAIIGTYYYDEFGAVEESTGTVDNPFLYAGYRYDKETGNYYLNSRM
FT                   YDPVTARFLQEDTYRGSYNDPLSLNLYTYCYNNPLIYDDPTGHWLHIAIGALVGAVAGV
FT                   AINAVSDYLDDGKFNKGWKSYAGAAVEGAITGGLAAATGGLSLGATIAINAGASFVGNV
FT                   AGQYISKGEVNWKEAAVSAVVGGGGAAAGHYAKKIVSKLPSIPKPPVISRAEQLLNKAK
FT                   ARVKVLGDAGMSRLNQISDNIASKISSKLSPQMSFAGVGNINLPKTSFRGNVKEVGIFK
FT                   KADTSVQKNFKDVVKTNEKRIEALNSSGGINKNINKTQSGSKSFYTVQNAEDGARLLND
FT                   GTPWPTEPHKANLGEGVYSWDNLEDAENYLKLKKRRTDVELNIYEFKVANKDLAKMKSL
FT                   DMTKLPDDEVDAFLDIHAKLNGGTPNHGLEYIRRATNIGVENYFHSSVFKYLKFTKK"
     MKKFKRFIAF FLIFSIIFTQ NQQILVDTFK NVDLDINLGV LSNITLPTIP TSEKTTTTQN        60
     RDIPNLEQMH TLELEELNNL TTENQSITME KQNLLSFQTP SIIEVRSIND STNLINWTYE       120
     EDFEYQLEVD GQIVDLKSVK GYVHNFDSNN KTHIYRIRSK SQEQFSQWSE AVTKATEPGK       180
     TLTDSVLPID RNLLKRRIPT ATNPIVALTD TISEPSVQYE VHVKGAPLSD WQNSKDGRLI       240
     VTNGIDAIKV SLLSPPSGLK IKYRVYSENG TWQPWTYDGG ICGIYGKNIQ MIEMKLEGIT       300
     TSFSIGYILT NNANQESFPL EMDGETSGTM GTNSGIFLAC LVNNNDSKVE VIDKDTTWKK       360
     SEGPHIIDGI VRVEPGVTLT IEPGTKVIFQ KYKYRENGLY INGKVIMEGT PSEKIQFSSM       420
     VDGQAVSTDQ YYFRGIYVLP TGEIKASYVD MELDRKDNYI LVNGDVSFNY CNFNCVGDSG       480
     IDWNYVIYAK VEREKVLNVS NCTFSNAGQG IGLGDSFGEV NITNNSFSNT IRDSIQVGIS       540
     DYETYSVLAN IKANTIVGGK NGISLKGIRS NIVNIKVTDN VIKNCSETGV YIEEYLGSLT       600
     FQRNTISGVD TNRVKELSGP IVVKVEKLGT NFSSVISAVN PKDVALKNTL SGNNFDAIVL       660
     NGTINENSRL FNGTNRYLVR SYLDISKDKT LSIEDGTIIH LRGEVVVYGC IRSEGKANNQ       720
     IVFTSVNSEY TLPYKPTSDP AQKIMDDFFP WINIRNSGSF LGLNTVINRG GGPRKAGGPG       780
     YCSINLDGKL TLINSSVFNS TNAGIDAFKD NESTEPSDLT IINCSITHNM GHGIWIGHIP       840
     ATIINSDIHQ NDSGIVTFAD DTVIAGNSFV GNRTSAVNYW NDTKDKYIDL RNNYWGASDG       900
     PYATDTGGGA WEGKGQKVNV YPGYAVVYPF LKTPSDCVPV GDLNNYVRSV QLRDQKWFGS       960
     QGVSVATGNY CKTFMDMEDC FPNLGLSLSH TYNSKDETVS ILGKGWRLSL QGEISDFSSS      1020
     AGTAMKKVVL PSGETQTFTV NSNGTFTAND SRNTLTKAGD TFTLTNKEQM QYLFNSSGKL      1080
     YCVKDKNGNA VNIAYDNGKI DRVYDETNKS FKLTYDAATG YIDKITESFG TVTGRIVDFN      1140
     YDSSKRLSSV TDASGNVTNY VYSGIGLLQD TKSGEGALLE RIIYTLDGGS YKVRQKIDNY      1200
     GNSFTYKYDD FVNRTIVTES NGWVKEYWCD SYGYPTVTIY PDRSTENKEY YLDASGENKY      1260
     GEIKASMDIY GNRTEYIRDG RGNVTKQINP DESEKNFAYD DKNNLIKEVN EDGNVTYYCY      1320
     DANKINLIQK VQPLNGTDPL VNPLDETKFA ITSYEYYSET ERVQNGYKVK GSLKTEKTPL      1380
     GNTTTFKYDA NGNKTVVTDG FGNNTVYTYD SYNNEASMTT SEGYKTTYVY DMNGRLEKAT      1440
     LHGGEVTRTV YDNEGQKLKE ITPNIYDAAL DNIDAHTYSG EHGTRFTYYY NGKVATATDA      1500
     MGNTTRYYYD KYGNVSKEIK PNKSVYLYQY DCHNRPIKTT FKESDASTTE ILIEEFNYSL      1560
     SYDRTLESNV LIKSHKQYID NTNTVTSILK FDYANRLVKV KNSDGTEIST KYTPSGLKLI      1620
     EKDEDSNETL YNYDALGRLI KKWTPISEND DVTYYSYSGF QYDKDGNKKV EWTGKNLVEY      1680
     GVSVSILDPN AIKLTYDYYK DGKVQSKVDN EGRRTDYEYS KDRVLTKETV FLTYGGKYEI      1740
     TEYRNNYLGK PIKTLVKTAK QDIIGNSITD SALSNMWTTY EYDKNGNLKN VKNYGVVDGT      1800
     DILSTTPVLN VTSYEYDNLN RETKQTKQAK NTAGNDTTIF TSKNYSWDGK VLNSRDGNGR      1860
     VTTNTYDLRG RLVKVRDPKG QYTLFTYDYL GRVLSKTISR LNEDYNSYIQ KFNAAINTTP      1920
     DSPNWDPEYD FNKDNVVDLY DNVIINRENI DKTLFEYDDM GRVIREIKSS RNPNTLAWDN      1980
     VTTKAYKYDN QGNVIKELDA LGYEQGSGAT PAEKIENGYG TEYTYNLLNK QTSVLTPASK      2040
     DKGLAFNSKY EYDGLGRVVK DISANQGSYT YEYNNSGKLT KTTLNKKDGS QLVIKTNQYD      2100
     LGDNLISEKD AKGIETKYEY NLLGKIRKVT TASDATINAN TIQYQYDIYG NQALSQESSG      2160
     RVDLTEYDNA GRKIHEKTQK SDGTQVIEKF YFNDGNGNVV AFIDGNGNKT TSTYDEQNKI      2220
     TSKRINVTYV DGSTKENRIT YEYDIFGQLI SETDPLGNVL KYKYDAFGRV IDKRDAYNKV      2280
     IQILTYNANG SQKESFDALN NEITYIYDKD KRLIKSINGD EATGTIAAEQ VYDERNNVIE      2340
     KRDGNGNSTK YQYDELNKLK SVTNALGQVT SYTYDDNGNM ETMTDGNGNV TYYEYNCANK      2400
     PIKIKTLKKD ITTNVSGNTV DLSTANLSEG YTYYVDGNIK TRTSKNTDVT TYTYDIYGRK      2460
     LTEVIGSINN SYTYDKNDNL LTVKDSTGTT TRTYDALNRT ITKDVPNGGT TKYLYDSTNG      2520
     VDPGCYAEVS TDAKGFVTTK IFDKAKRLYK VTESGNTTTY NYYDNGNRQE VIYPNGSKEV      2580
     YYYNKNNTLA KLENKNPNGS IAESFVYEYD NSGNITAKVD KKGKTIYTYD RLNRVETTTE      2640
     QDGKITTYKY DNAGNRTSMS AVFGSNVETT EYYYDSLNRL RYSHQLLTGI QDSGVALTAE      2700
     KQNSKYDYDE NGNQIKVTET SYDSTKQQNV VKETINKYDK LNQLIETTTK DGVVVKNAYN      2760
     AEGYRVAKDV NGVKTNFVYE GDKVVLELDA SGNEKGRNIY GENLISRNAD GQKVYYLYNG      2820
     HSDVTTLTNE AGAIIGTYYY DEFGAVEEST GTVDNPFLYA GYRYDKETGN YYLNSRMYDP      2880
     VTARFLQEDT YRGSYNDPLS LNLYTYCYNN PLIYDDPTGH WLHIAIGALV GAVAGVAINA      2940
     VSDYLDDGKF NKGWKSYAGA AVEGAITGGL AAATGGLSLG ATIAINAGAS FVGNVAGQYI      3000
     SKGEVNWKEA AVSAVVGGGG AAAGHYAKKI VSKLPSIPKP PVISRAEQLL NKAKARVKVL      3060
     GDAGMSRLNQ ISDNIASKIS SKLSPQMSFA GVGNINLPKT SFRGNVKEVG IFKKADTSVQ      3120
     KNFKDVVKTN EKRIEALNSS GGINKNINKT QSGSKSFYTV QNAEDGARLL NDGTPWPTEP      3180
     HKANLGEGVY SWDNLEDAEN YLKLKKRRTD VELNIYEFKV ANKDLAKMKS LDMTKLPDDE      3240
     VDAFLDIHAK LNGGTPNHGL EYIRRATNIG VENYFHSSVF KYLKFTKK                   3288
//

If you have problems or comments...

PBIL Back to PBIL home page