(data stored in ACNUC7421 zone)

EMBL: CP002160.PE546

CP002160.PE546       Location/Qualifiers
FT   CDS             704364..704960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0564"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reh:H16_B2107 rhs family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50337"
FT                   /db_xref="InterPro:IPR028048"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR49"
FT                   /inference="similar to AA sequence:KEGG:H16_B2107"
FT                   /protein_id="ADL50337.1"
FT                   /translation="MSRLNQISDNIASKISSKLSPQMSFAGVGNVNLPKTNFRDTVKDL
FT                   GFFKKADTSVQKNFKEAVKTNEKRLEALNSSGGINKGAGNPVSRKQALSEIKKDLGISK
FT                   SQQPLEQKMVPLLDENKNRILDANNNFVETRELTYSVQGKFDVQGNPIDKVVIQDHSYG
FT                   HYYNSGIGNQPSHFNVRPSTNTKNGAVQGMKDHYY"
     MSRLNQISDN IASKISSKLS PQMSFAGVGN VNLPKTNFRD TVKDLGFFKK ADTSVQKNFK        60
     EAVKTNEKRL EALNSSGGIN KGAGNPVSRK QALSEIKKDL GISKSQQPLE QKMVPLLDEN       120
     KNRILDANNN FVETRELTYS VQGKFDVQGN PIDKVVIQDH SYGHYYNSGI GNQPSHFNVR       180
     PSTNTKNGAV QGMKDHYY                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page