(data stored in ACNUC7421 zone)

EMBL: CP002160.PE547

CP002160.PE547       Location/Qualifiers
FT   CDS             704979..705362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0565"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bce:BC0929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50338"
FT                   /db_xref="InterPro:IPR028957"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR50"
FT                   /inference="similar to AA sequence:KEGG:BC0929"
FT                   /protein_id="ADL50338.1"
FT                   /translation="MFEGIDNAVVIKNIFGDKNVFEKAELINVNWQMIDSRIELSILVH
FT                   DEPTKVPKKWGVFESVYVRLEFYGLNYLRIDVKEDKPRIEKFTMQSNSDKYCCKISMSD
FT                   EQEIQCTFEVARIQNIKPFVDKQ"
     MFEGIDNAVV IKNIFGDKNV FEKAELINVN WQMIDSRIEL SILVHDEPTK VPKKWGVFES        60
     VYVRLEFYGL NYLRIDVKED KPRIEKFTMQ SNSDKYCCKI SMSDEQEIQC TFEVARIQNI       120
     KPFVDKQ                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page