(data stored in ACNUC7421 zone)

EMBL: CP002160.PE55

CP002160.PE55        Location/Qualifiers
FT   CDS             94102..95244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0057"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_1887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49846"
FT                   /db_xref="GOA:D9SMR1"
FT                   /db_xref="UniProtKB/TrEMBL:D9SMR1"
FT                   /inference="similar to AA sequence:KEGG:Cbei_1887"
FT                   /protein_id="ADL49846.1"
FT                   /translation="MGKFFSKAIFYEQWSRLWAFIIAIVFIIGIKPINFLGSVKTIESI
FT                   KSFDEIPAMMSLGINLDLADYFLLIVMLITLVAMSTGSNKQKSLSFLNSKNVTRKQILG
FT                   TQFIAVLTISMIAIIISTIVRVIVYFSVKEVFNEYLNIYISDIVIYFFTVSIVTINVLS
FT                   VTFLYQAIFGKTIISVLAIPATLGYLIIGPIILWRINYHFRFIDALGNSIEKVLFKLYD
FT                   VATQQYLRGGDYLVNGTCSKRDSISWMVIVFIITVILIFIMFLLNQYYEVQNLGNIFVF
FT                   SKVKVATNLLITIMSASFISIILYAIYSKIHAEATGEALRIMLAQDSFSPGLVKSSENL
FT                   VRHICNIISFVVSPFIYMLLNKIVNVIDGVEGKKIRKIKI"
     MGKFFSKAIF YEQWSRLWAF IIAIVFIIGI KPINFLGSVK TIESIKSFDE IPAMMSLGIN        60
     LDLADYFLLI VMLITLVAMS TGSNKQKSLS FLNSKNVTRK QILGTQFIAV LTISMIAIII       120
     STIVRVIVYF SVKEVFNEYL NIYISDIVIY FFTVSIVTIN VLSVTFLYQA IFGKTIISVL       180
     AIPATLGYLI IGPIILWRIN YHFRFIDALG NSIEKVLFKL YDVATQQYLR GGDYLVNGTC       240
     SKRDSISWMV IVFIITVILI FIMFLLNQYY EVQNLGNIFV FSKVKVATNL LITIMSASFI       300
     SIILYAIYSK IHAEATGEAL RIMLAQDSFS PGLVKSSENL VRHICNIISF VVSPFIYMLL       360
     NKIVNVIDGV EGKKIRKIKI                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page