(data stored in ACNUC7421 zone)

EMBL: CP002160.PE551

CP002160.PE551       Location/Qualifiers
FT   CDS             complement(709785..710927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0571"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="KEGG: cbe:Cbei_1821 DEAD/DEAH box helicase
FT                   domain-containing protein; PFAM: DEAD/DEAH box helicase
FT                   domain protein; helicase domain protein; SMART: DEAD-like
FT                   helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50342"
FT                   /db_xref="GOA:D9SR54"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR54"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ADL50342.1"
FT                   /translation="MNNSFIDLKINQNLIEGLEKQNITIPTEIQQLVIKSALENKDIIG
FT                   ESYTGSGKTLSYLLPIFHKIDTAKREMQAIILAPTHELVMQIEEQVSLLAKNSEIPVTS
FT                   LTIIGEASMEKQIKKLKDNKPHIIVGTIGRVLDLIQKKKIKAHTVKTIVIDEADNLLSE
FT                   SSLGTVNNIIKTTMRDRQLMAFSATINPKTLDTAKALMKEPEVFKTDGKVAMNPRISHE
FT                   YIVCSHRDKFEILRKLIAATKTERAIVFLNKNEEIQLITDKLNYHSKNAGGIYGAASKE
FT                   ERKNTINSFKSGKINLLVSSDLSARGLDVPEVTHIFNLDFPVNTNDYSHRAGRTARGNL
FT                   SGTCISIITEKELAAIRVYEREFNVKFEQIDVYEGRIHKA"
     MNNSFIDLKI NQNLIEGLEK QNITIPTEIQ QLVIKSALEN KDIIGESYTG SGKTLSYLLP        60
     IFHKIDTAKR EMQAIILAPT HELVMQIEEQ VSLLAKNSEI PVTSLTIIGE ASMEKQIKKL       120
     KDNKPHIIVG TIGRVLDLIQ KKKIKAHTVK TIVIDEADNL LSESSLGTVN NIIKTTMRDR       180
     QLMAFSATIN PKTLDTAKAL MKEPEVFKTD GKVAMNPRIS HEYIVCSHRD KFEILRKLIA       240
     ATKTERAIVF LNKNEEIQLI TDKLNYHSKN AGGIYGAASK EERKNTINSF KSGKINLLVS       300
     SDLSARGLDV PEVTHIFNLD FPVNTNDYSH RAGRTARGNL SGTCISIITE KELAAIRVYE       360
     REFNVKFEQI DVYEGRIHKA                                                   380
//

If you have problems or comments...

PBIL Back to PBIL home page