(data stored in ACNUC7421 zone)

EMBL: CP002160.PE552

CP002160.PE552       Location/Qualifiers
FT   CDS             711114..711827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0572"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG:
FT                   bay:RBAM_006580 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50343"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR55"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ADL50343.1"
FT                   /translation="MGVLGRFKAIMEANINALLDKAEDPSKMIDQYLRDLNSDLGKVKA
FT                   ETAAIMAEEQRTKRVYEECGVEIEKMQNYAKKAVQAGNDNDARQFLGKKAELLQKQESL
FT                   KMAYDAAKANAIKMKSMHDKLQRDIGQLNARKDAIKAKVSIAKTQERINKMGASITNAG
FT                   ANISAFDRMEEKADRMLDEANAMAELNKSSEEVDINLLTSKYDSSINIEDELEMLKGND
FT                   IEEELKALKENSTQD"
     MGVLGRFKAI MEANINALLD KAEDPSKMID QYLRDLNSDL GKVKAETAAI MAEEQRTKRV        60
     YEECGVEIEK MQNYAKKAVQ AGNDNDARQF LGKKAELLQK QESLKMAYDA AKANAIKMKS       120
     MHDKLQRDIG QLNARKDAIK AKVSIAKTQE RINKMGASIT NAGANISAFD RMEEKADRML       180
     DEANAMAELN KSSEEVDINL LTSKYDSSIN IEDELEMLKG NDIEEELKAL KENSTQD          237
//

If you have problems or comments...

PBIL Back to PBIL home page