(data stored in ACNUC7421 zone)

EMBL: CP002160.PE553

CP002160.PE553       Location/Qualifiers
FT   CDS             711918..713126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0573"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lba:Lebu_1615 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50344"
FT                   /db_xref="GOA:D9SR56"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR56"
FT                   /inference="similar to AA sequence:KEGG:Lebu_1615"
FT                   /protein_id="ADL50344.1"
FT                   /translation="MDKESYKCECCGGTMEFDVKTQKLKCPNCDNMIEIIDNKNFVIEH
FT                   KFTLIDRETIKVSMKNSSTMECQGCGAHVEVASDCTAVSCPYCGSSYVLAEKQEEILIP
FT                   DGVIPFKVEKAEIAQMMRKWIYSRWLAPNKLKALYENDKIQGIYVPYWTFDAMVDCPYT
FT                   AMGGRDRQVAYQDREGKVHYRTETDWFFTKGRINYFFDDVQVTASRNMNPSLINGIEPF
FT                   TTKDIASYSPSYLSGFSAETYSIGLEEGNIEAKKKMRNELHRMAEKEVTRHYDRVREVR
FT                   LNPSFYDETYKHVLLPVYATSYSYNGKNYHVLINGETGKMKGDYPKSPFKIAILVIFAM
FT                   IIAAIILYLKNHSEIRKVSFNNNIYQTQLSNSQNIFNNIYEEVNKFNNQEVYIHGVIFK
FT                   SVL"
     MDKESYKCEC CGGTMEFDVK TQKLKCPNCD NMIEIIDNKN FVIEHKFTLI DRETIKVSMK        60
     NSSTMECQGC GAHVEVASDC TAVSCPYCGS SYVLAEKQEE ILIPDGVIPF KVEKAEIAQM       120
     MRKWIYSRWL APNKLKALYE NDKIQGIYVP YWTFDAMVDC PYTAMGGRDR QVAYQDREGK       180
     VHYRTETDWF FTKGRINYFF DDVQVTASRN MNPSLINGIE PFTTKDIASY SPSYLSGFSA       240
     ETYSIGLEEG NIEAKKKMRN ELHRMAEKEV TRHYDRVREV RLNPSFYDET YKHVLLPVYA       300
     TSYSYNGKNY HVLINGETGK MKGDYPKSPF KIAILVIFAM IIAAIILYLK NHSEIRKVSF       360
     NNNIYQTQLS NSQNIFNNIY EEVNKFNNQE VYIHGVIFKS VL                          402
//

If you have problems or comments...

PBIL Back to PBIL home page