(data stored in ACNUC7421 zone)

EMBL: CP002160.PE555

CP002160.PE555       Location/Qualifiers
FT   CDS             714431..716131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0575"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="KEGG: afl:Aflv_1304 methyl-accepting chemotaxis
FT                   protein; PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50346"
FT                   /db_xref="GOA:D9SR58"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR58"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ADL50346.1"
FT                   /translation="MKNLRLKGRIVRLLILSVICISSSLLGLSYYFTNKATQSSVTDEL
FT                   TSTSNLVSAVLDSSYPGTWALNGEKLTKGKNPLHDIVGIIDKVKEQSNSEVTIFANDTR
FT                   FITTLIVDNKRNVGTKADEKVIEIVLKNGEEFQSQVTISGVKYIGKYTPIKNGKNEIVG
FT                   MIFVGKEYAVLMKPLTESIVYMVGCTIIVAILMIILGGVFASRVAKPISISVKALKRVS
FT                   SGDLTEDIPSNLSIRKDEAAELAEAVGDMQNFLNNIVNNIKSTTSNMFNSSSNLLTVSE
FT                   NMTAASSNITHAIGEMASGTVGQAEDISDISQSLNEFGNKIQEAKEATSMIHDGSIEIE
FT                   KMTNENNVQMKMVVDSIGNVKEQFDEFANSVSILGSNITRVDEITGVINSIADQTNLLA
FT                   LNAAIEAARAGESGKGFAVVADEIRKLAEESRKSSESIKELVAFIAKDTYKIVDNSKEV
FT                   NNKLAEQLEAINKTLGSFEGITKSVSDIIPKINQVDKNSESINESKTTLISKAENAASI
FT                   AEEISAATEEIAASSEEMASSAIEVEKVSEVLNLETKKLIDYVSIFKSK"
     MKNLRLKGRI VRLLILSVIC ISSSLLGLSY YFTNKATQSS VTDELTSTSN LVSAVLDSSY        60
     PGTWALNGEK LTKGKNPLHD IVGIIDKVKE QSNSEVTIFA NDTRFITTLI VDNKRNVGTK       120
     ADEKVIEIVL KNGEEFQSQV TISGVKYIGK YTPIKNGKNE IVGMIFVGKE YAVLMKPLTE       180
     SIVYMVGCTI IVAILMIILG GVFASRVAKP ISISVKALKR VSSGDLTEDI PSNLSIRKDE       240
     AAELAEAVGD MQNFLNNIVN NIKSTTSNMF NSSSNLLTVS ENMTAASSNI THAIGEMASG       300
     TVGQAEDISD ISQSLNEFGN KIQEAKEATS MIHDGSIEIE KMTNENNVQM KMVVDSIGNV       360
     KEQFDEFANS VSILGSNITR VDEITGVINS IADQTNLLAL NAAIEAARAG ESGKGFAVVA       420
     DEIRKLAEES RKSSESIKEL VAFIAKDTYK IVDNSKEVNN KLAEQLEAIN KTLGSFEGIT       480
     KSVSDIIPKI NQVDKNSESI NESKTTLISK AENAASIAEE ISAATEEIAA SSEEMASSAI       540
     EVEKVSEVLN LETKKLIDYV SIFKSK                                            566
//

If you have problems or comments...

PBIL Back to PBIL home page