(data stored in ACNUC7421 zone)

EMBL: CP002160.PE557

CP002160.PE557       Location/Qualifiers
FT   CDS             718270..718965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0577"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cbb:CLD_1399 ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50348"
FT                   /db_xref="GOA:D9SR60"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR60"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50348.1"
FT                   /translation="MLKVTNLTKKYGKMLAVKNVSFFVETGEIAVLAGPNGAGKSTVIK
FT                   SIVGLLRYQGSITVNDKINKSIEGKSYIGYIPEIPSLFPLLTVSEHITLMAHAFGIKDY
FT                   ETEAEELLKAFDLWDKKDKFGSELSKGMQQKVSICCAIITKPKILLVDEPMVGLDPKAI
FT                   RTMKNLLLKLKEQGTSIVVSTHLLDSVQDLWDRIIIMKDGEFVYSNTKHEIGKEDKSLE
FT                   DIFFEYTEE"
     MLKVTNLTKK YGKMLAVKNV SFFVETGEIA VLAGPNGAGK STVIKSIVGL LRYQGSITVN        60
     DKINKSIEGK SYIGYIPEIP SLFPLLTVSE HITLMAHAFG IKDYETEAEE LLKAFDLWDK       120
     KDKFGSELSK GMQQKVSICC AIITKPKILL VDEPMVGLDP KAIRTMKNLL LKLKEQGTSI       180
     VVSTHLLDSV QDLWDRIIIM KDGEFVYSNT KHEIGKEDKS LEDIFFEYTE E                231
//

If you have problems or comments...

PBIL Back to PBIL home page