(data stored in ACNUC7421 zone)

EMBL: CP002160.PE558

CP002160.PE558       Location/Qualifiers
FT   CDS             718969..720552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0578"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cno:NT01CX_1192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50349"
FT                   /db_xref="GOA:D9SR61"
FT                   /db_xref="InterPro:IPR031584"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR61"
FT                   /inference="similar to AA sequence:KEGG:NT01CX_1192"
FT                   /protein_id="ADL50349.1"
FT                   /translation="MKALIYLMKTNIINYFKQLKKKPAKAIGPIAMVVFMITMFLSKND
FT                   TSKTLDIDIFISLFLLITISAFIYSLYTGTKSINSKFNMADVNLIFVSPIKPQTVMIYG
FT                   IIKKMSVELFAYFYIIYQIPNLTKSMDITIGQTVSVIIIFIIMQIVFCNIVKLLVFVLN
FT                   SKYPLLGRIIRLTIKIVGAVLCVAAVLIFLKGRPITFVKELYSSIGQDSWIKFIPIFGW
FT                   VREMVYQSLTTINMTFFLYLAMIIFLSVLLVYITYCIEIDFYEDMLSSAEANEVIKKAK
FT                   NREQVTTESNRNNRLFKAFRKVQLKLDNKYKAEVLFYKHLNEYSKRSFLFFINTYSIIL
FT                   LLVSLTLGIFAKGVEIKLVYMIFCGLLFFGAGLAGKIYYEITNPLIFMIPDSPQKKLFY
FT                   GTASSLIKLVSDSIILFIPFGILSGVSIIEMFLCCISYVLLGAMFSYSGLVGFRISNYF
FT                   GFTDQISQGVFFMFFQMFLLVPAAIMVITLGVATEFSGYAIYLAMIAYTSVLTVIFSFG
FT                   AVGIFDNMEL"
     MKALIYLMKT NIINYFKQLK KKPAKAIGPI AMVVFMITMF LSKNDTSKTL DIDIFISLFL        60
     LITISAFIYS LYTGTKSINS KFNMADVNLI FVSPIKPQTV MIYGIIKKMS VELFAYFYII       120
     YQIPNLTKSM DITIGQTVSV IIIFIIMQIV FCNIVKLLVF VLNSKYPLLG RIIRLTIKIV       180
     GAVLCVAAVL IFLKGRPITF VKELYSSIGQ DSWIKFIPIF GWVREMVYQS LTTINMTFFL       240
     YLAMIIFLSV LLVYITYCIE IDFYEDMLSS AEANEVIKKA KNREQVTTES NRNNRLFKAF       300
     RKVQLKLDNK YKAEVLFYKH LNEYSKRSFL FFINTYSIIL LLVSLTLGIF AKGVEIKLVY       360
     MIFCGLLFFG AGLAGKIYYE ITNPLIFMIP DSPQKKLFYG TASSLIKLVS DSIILFIPFG       420
     ILSGVSIIEM FLCCISYVLL GAMFSYSGLV GFRISNYFGF TDQISQGVFF MFFQMFLLVP       480
     AAIMVITLGV ATEFSGYAIY LAMIAYTSVL TVIFSFGAVG IFDNMEL                     527
//

If you have problems or comments...

PBIL Back to PBIL home page