(data stored in ACNUC7421 zone)

EMBL: CP002160.PE559

CP002160.PE559       Location/Qualifiers
FT   CDS             720580..720846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50350"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR62"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0044"
FT                   /protein_id="ADL50350.1"
FT                   /translation="MMVKIWGKLIKNNKIIKQAVASSDIHDTYQENLTECIVELCYGFD
FT                   IGKPYWLTKNADEYNKRYKTTFNVDNFIESIEFDKFIIEALEE"
     MMVKIWGKLI KNNKIIKQAV ASSDIHDTYQ ENLTECIVEL CYGFDIGKPY WLTKNADEYN        60
     KRYKTTFNVD NFIESIEFDK FIIEALEE                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page