(data stored in ACNUC7421 zone)

EMBL: CP002160.PE564

CP002160.PE564       Location/Qualifiers
FT   CDS             723835..724512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0584"
FT                   /product="ABC transporter related"
FT                   /note="KEGG: cac:CAC3560 ABC-type transporter, ATPase
FT                   component; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50355"
FT                   /db_xref="GOA:D9SR67"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR67"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ADL50355.1"
FT                   /translation="MSYVIEVEDLHKSYQMGDMSVDILKGISLNISLGEFVSIMGPSGS
FT                   GKSTLLYLLGGLDKPTKGSIKIKGSDIAKMNDKAESIMRRREIGFVFQFYNLIPNLTVE
FT                   ENIMLPLLLDGKKTNKYKKELNDILEIVGLTERRNHTPRELSGGQQQRVAIARALINEP
FT                   DIILADEPIGNLDSKTGNEIMNLFQKINKEKGKTIVQVTHSIESAGFGQRIINVRDGKV
FT                   ENI"
     MSYVIEVEDL HKSYQMGDMS VDILKGISLN ISLGEFVSIM GPSGSGKSTL LYLLGGLDKP        60
     TKGSIKIKGS DIAKMNDKAE SIMRRREIGF VFQFYNLIPN LTVEENIMLP LLLDGKKTNK       120
     YKKELNDILE IVGLTERRNH TPRELSGGQQ QRVAIARALI NEPDIILADE PIGNLDSKTG       180
     NEIMNLFQKI NKEKGKTIVQ VTHSIESAGF GQRIINVRDG KVENI                       225
//

If you have problems or comments...

PBIL Back to PBIL home page