(data stored in ACNUC7421 zone)

EMBL: CP002160.PE565

CP002160.PE565       Location/Qualifiers
FT   CDS             724512..725678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0585"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_3080 secretion protein HlyD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50356"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR68"
FT                   /inference="similar to AA sequence:KEGG:Amet_3080"
FT                   /protein_id="ADL50356.1"
FT                   /translation="MKKLFIMFLIAAAMTTLTACSESQQSVTVTASNSTEEASSTGNVQ
FT                   AYGVIKSGTVKNINVNFPTAVEEIYVKAGQKVTKGEKLVRINISEYEGLIKNKEHEARV
FT                   AQLEVQSAQNGENIDLQNETIRKLNEDLVTKQGYLNNNSSPEMIKLQKDLTYCQNAYNK
FT                   AKSALDANEAAAKQNKLSSATELEESRSKEQEAFKALEDVKFDIDTLNAKLKEEIGQIQ
FT                   SDISKAQIQQNTITAGNVPEVQTEKLNQLNEEIALMRKNLEEAFLKDGIISCDVDSAVV
FT                   GDVISNVGEAVEKNVKLLSLIDTKQLIVEADISEEFYKDVKQGATVKIIPIADKSKEYT
FT                   GKVTYIASNVTKENTESIIKAQITIENADEFLLPGLNVNLQINAQGVK"
     MKKLFIMFLI AAAMTTLTAC SESQQSVTVT ASNSTEEASS TGNVQAYGVI KSGTVKNINV        60
     NFPTAVEEIY VKAGQKVTKG EKLVRINISE YEGLIKNKEH EARVAQLEVQ SAQNGENIDL       120
     QNETIRKLNE DLVTKQGYLN NNSSPEMIKL QKDLTYCQNA YNKAKSALDA NEAAAKQNKL       180
     SSATELEESR SKEQEAFKAL EDVKFDIDTL NAKLKEEIGQ IQSDISKAQI QQNTITAGNV       240
     PEVQTEKLNQ LNEEIALMRK NLEEAFLKDG IISCDVDSAV VGDVISNVGE AVEKNVKLLS       300
     LIDTKQLIVE ADISEEFYKD VKQGATVKII PIADKSKEYT GKVTYIASNV TKENTESIIK       360
     AQITIENADE FLLPGLNVNL QINAQGVK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page