(data stored in ACNUC7421 zone)

EMBL: CP002160.PE566

CP002160.PE566       Location/Qualifiers
FT   CDS             725723..728212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0586"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   amt:Amet_3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50357"
FT                   /db_xref="GOA:D9SR69"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR69"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADL50357.1"
FT                   /translation="MSIVLKMLIKNITSKKARTFLILFSIILSTAVFFSSIAISGSILK
FT                   TVLGSVTQVVGVSDITISPTEKSDSKFLSQSALEKYKNDFDIVVGELDASGVYNVTLGE
FT                   SVPVIVKGVVPEELNKVNPFSIASSLENEEFKGKSIIVSSTVAEDHNLKLGDTITVVIK
FT                   GQEQRFTLWGIASAKGPFSKAITVPNFAIPEETMASLLDAHGKKNILYIKLKDTSLKKS
FT                   MVKTLQSDYKSYQVKETFNVEKLQSNLSDISSIFLLLSGIVFFMSAFIIYSSFKVIAAE
FT                   RIPVIGTLRSIGATKKTTNTILLGESILYGTIGGFLGCGFGIGLLYVLSLYMSDIANVT
FT                   PGLQLNTTIQFSFAQLAVAFIISILLSFISSIFPIMKISKIPIKDVILRTAELVKKDKK
FT                   IKILLPIICVVIAYLITIPKYNPDDNLFLGLAMLFALLAIVFFIPYATKLFVKLFEKIY
FT                   VVIFGNIGILAAKNLRENKGVLNNMIMLAISISVLLAINTTGYNTVLSSLNSYKGANFD
FT                   LKITVSNAENSFVNKLYNKDGVEDVYVDYEFENIKIVDTDTAIGTVKGIDMLKFSDFWT
FT                   ISTEEDFGDMSKELDAGRNIMISSTLQRTLEVQKGDVLKLKTTSGEKEYKIIGFFKDFM
FT                   NDSDYALVSERFMKADMKSSEASAYYVRSSIAPKELGKELKADFKKLSPKINTKAQLEQ
FT                   IEVDDNVNTISLMQSFCIMAIVIGFFGVINNLVLSFMQRKQSLAMFRSVGMSKKQIVSM
FT                   TFIEAFTGAVIGGIMGVVGGIGMTYILSKLDDSKLVIQIEYLGLYVAIGILVMILASII
FT                   PVVKSAKLNLIEAVKQE"
     MSIVLKMLIK NITSKKARTF LILFSIILST AVFFSSIAIS GSILKTVLGS VTQVVGVSDI        60
     TISPTEKSDS KFLSQSALEK YKNDFDIVVG ELDASGVYNV TLGESVPVIV KGVVPEELNK       120
     VNPFSIASSL ENEEFKGKSI IVSSTVAEDH NLKLGDTITV VIKGQEQRFT LWGIASAKGP       180
     FSKAITVPNF AIPEETMASL LDAHGKKNIL YIKLKDTSLK KSMVKTLQSD YKSYQVKETF       240
     NVEKLQSNLS DISSIFLLLS GIVFFMSAFI IYSSFKVIAA ERIPVIGTLR SIGATKKTTN       300
     TILLGESILY GTIGGFLGCG FGIGLLYVLS LYMSDIANVT PGLQLNTTIQ FSFAQLAVAF       360
     IISILLSFIS SIFPIMKISK IPIKDVILRT AELVKKDKKI KILLPIICVV IAYLITIPKY       420
     NPDDNLFLGL AMLFALLAIV FFIPYATKLF VKLFEKIYVV IFGNIGILAA KNLRENKGVL       480
     NNMIMLAISI SVLLAINTTG YNTVLSSLNS YKGANFDLKI TVSNAENSFV NKLYNKDGVE       540
     DVYVDYEFEN IKIVDTDTAI GTVKGIDMLK FSDFWTISTE EDFGDMSKEL DAGRNIMISS       600
     TLQRTLEVQK GDVLKLKTTS GEKEYKIIGF FKDFMNDSDY ALVSERFMKA DMKSSEASAY       660
     YVRSSIAPKE LGKELKADFK KLSPKINTKA QLEQIEVDDN VNTISLMQSF CIMAIVIGFF       720
     GVINNLVLSF MQRKQSLAMF RSVGMSKKQI VSMTFIEAFT GAVIGGIMGV VGGIGMTYIL       780
     SKLDDSKLVI QIEYLGLYVA IGILVMILAS IIPVVKSAKL NLIEAVKQE                   829
//

If you have problems or comments...

PBIL Back to PBIL home page