(data stored in ACNUC7421 zone)

EMBL: CP002160.PE567

CP002160.PE567       Location/Qualifiers
FT   CDS             complement(728492..729733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0587"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   ckr:CKR_0448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50358"
FT                   /db_xref="GOA:D9SR70"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR70"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50358.1"
FT                   /translation="MNYKRKANMALGISVIFFCLCVVLRYFYRDAVIFKLLLFVAEASL
FT                   VGGIADWFAVTALFTKPLGFTYHTEIIPRNRKSIINSTANLVETDLLSKQTLKKHIDNL
FT                   AIVELLVKYFDEDKERKTNYIDKLSQFIMKYICKKDLKVAASYIENLLRKEGKNVSLSN
FT                   KLKDFIEDKFIYENRIVWVQDLLNKLSKGELDELILTISRKILANSEEKSSFSLKNLLK
FT                   KLNVSMAEDLANLIKSQLKIILTELMKEESGLPQECVENIIRSLDGIELSPASIEQWKL
FT                   NLLESTDFKPIIEAQLPLAINEISINTIVEKLWDYFKENSTIKSAIDRGIKELICDLLE
FT                   ENHNVIGSIVSDTLNNFTDEKLNAFVEDKAGEDLQWIRINGSVLGGCIGLVLFGFLNLI
FT                   FEPYVSPIIRGLLS"
     MNYKRKANMA LGISVIFFCL CVVLRYFYRD AVIFKLLLFV AEASLVGGIA DWFAVTALFT        60
     KPLGFTYHTE IIPRNRKSII NSTANLVETD LLSKQTLKKH IDNLAIVELL VKYFDEDKER       120
     KTNYIDKLSQ FIMKYICKKD LKVAASYIEN LLRKEGKNVS LSNKLKDFIE DKFIYENRIV       180
     WVQDLLNKLS KGELDELILT ISRKILANSE EKSSFSLKNL LKKLNVSMAE DLANLIKSQL       240
     KIILTELMKE ESGLPQECVE NIIRSLDGIE LSPASIEQWK LNLLESTDFK PIIEAQLPLA       300
     INEISINTIV EKLWDYFKEN STIKSAIDRG IKELICDLLE ENHNVIGSIV SDTLNNFTDE       360
     KLNAFVEDKA GEDLQWIRIN GSVLGGCIGL VLFGFLNLIF EPYVSPIIRG LLS              413
//

If you have problems or comments...

PBIL Back to PBIL home page