(data stored in ACNUC7421 zone)

EMBL: CP002160.PE568

CP002160.PE568       Location/Qualifiers
FT   CDS             complement(729745..731049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0588"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   dae:Dtox_1997 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50359"
FT                   /db_xref="GOA:D9SR71"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR71"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ADL50359.1"
FT                   /translation="MERNISKEKRKNSNIATWILLIFSAVFFISYPFHYSFLGGLISSL
FT                   CCAAMIGGLADWFAVVALFRTPLNSNVLRKLFESSKFIRTEIIPKNRERIFQALVDMVE
FT                   KELLTKESIISKLENINPSGIIIDQIKTDKKQNLHIILDTVFKEIVCNLNEKDLENIET
FT                   LTNKILKDNLKSLELSNIISQVLDWMWDNGYKEKITDILIDKIEELSKTYEAKMLIQDA
FT                   VLHILELNRGSFLIMIVGFFVKGNLENISKGVQEKLVGFLADMREPDSIERGQIQSFAK
FT                   KQLDRLKTDDALKNSIENWKNEKLVGNDAVIKKLGEILTQYISSLKSEPTKTFHITEGL
FT                   LDKVENQLEDFVINEEKQITFNTAIKNIIEQTVEKNHYKIGLIVKEKLDGISGEELSNM
FT                   IEPIIGSDLQLIRINGSLVGGLVGIITYLLTFWIV"
     MERNISKEKR KNSNIATWIL LIFSAVFFIS YPFHYSFLGG LISSLCCAAM IGGLADWFAV        60
     VALFRTPLNS NVLRKLFESS KFIRTEIIPK NRERIFQALV DMVEKELLTK ESIISKLENI       120
     NPSGIIIDQI KTDKKQNLHI ILDTVFKEIV CNLNEKDLEN IETLTNKILK DNLKSLELSN       180
     IISQVLDWMW DNGYKEKITD ILIDKIEELS KTYEAKMLIQ DAVLHILELN RGSFLIMIVG       240
     FFVKGNLENI SKGVQEKLVG FLADMREPDS IERGQIQSFA KKQLDRLKTD DALKNSIENW       300
     KNEKLVGNDA VIKKLGEILT QYISSLKSEP TKTFHITEGL LDKVENQLED FVINEEKQIT       360
     FNTAIKNIIE QTVEKNHYKI GLIVKEKLDG ISGEELSNMI EPIIGSDLQL IRINGSLVGG       420
     LVGIITYLLT FWIV                                                         434
//

If you have problems or comments...

PBIL Back to PBIL home page