(data stored in ACNUC7421 zone)

EMBL: CP002160.PE569

CP002160.PE569       Location/Qualifiers
FT   CDS             731364..733673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0589"
FT                   /product="Alpha-L-fucosidase"
FT                   /EC_number="3.2.1.51"
FT                   /note="KEGG: cce:Ccel_1020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50360"
FT                   /db_xref="GOA:D9SR72"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR72"
FT                   /inference="protein motif:PRIAM:3.2.1.51"
FT                   /protein_id="ADL50360.1"
FT                   /translation="MSIKDLKNSEDLFKLWYDEPAEVWNWDQALPVGNGKLGAMVFGHV
FT                   HKEQIQLNEESLWSGGYLDRNNPDALAQLPKVRQLLFDGKLKEAERLCAIAMMGTPEHQ
FT                   RHYETLGDLFIDFYHDSDEVKNYRRELDINKAMVTVQYEIDGVNFKREILSSAVDDAIV
FT                   IRITADKKEAISFRGFVGRELFMDTRTALNDSTVALRGGCGGPDSINYSIILKGTSEGG
FT                   NLYTMGGNIVVENADAVTLYLTSKTSYLSNDFDAVAISTAEAVSKRTYESILQDHIAEY
FT                   QSYFSRMTLQLGNKQEALELSKIPTDERLERVKEGKLDDGLISLYFHFGRYLLISCSRP
FT                   GTLPANLQGIWNKHHTSPWGCKFTININTEMNYWPAETCNLSDCHTPLFDLIEKMREPG
FT                   RHTAKVMYDCGGFVAHHNVDLWGDTAPQDHWMPATVWPMGAAWLCLHLWEHYEFTCDLK
FT                   FLKKAYETLKESAEFFVDYLIEDRNGYLVTCPSVSPENTYRLESGETGSLCIGPSMDSQ
FT                   IIYALFSSCIEASELLNTDKEFAETLISLRERLPKPSIGKYGQIMEWAEDYDEVEPGHR
FT                   HISQLFALHPSNQITVKDTPQLAKAARNTLERRLAHGGGHTGWSRAWIINFWARLEEGE
FT                   KAYENINALLAKSTLINLLDNHPPFQIDGNFGGAAGVAEMLVQSHSNEINIFPAMPKQW
FT                   SEGEVTGLCARGGFELSIKWTENKAYVTVTSKAGNRCIIRTPRFAHTSEEVSVEKLQDN
FT                   VIAFDTIKGEDYHLEF"
     MSIKDLKNSE DLFKLWYDEP AEVWNWDQAL PVGNGKLGAM VFGHVHKEQI QLNEESLWSG        60
     GYLDRNNPDA LAQLPKVRQL LFDGKLKEAE RLCAIAMMGT PEHQRHYETL GDLFIDFYHD       120
     SDEVKNYRRE LDINKAMVTV QYEIDGVNFK REILSSAVDD AIVIRITADK KEAISFRGFV       180
     GRELFMDTRT ALNDSTVALR GGCGGPDSIN YSIILKGTSE GGNLYTMGGN IVVENADAVT       240
     LYLTSKTSYL SNDFDAVAIS TAEAVSKRTY ESILQDHIAE YQSYFSRMTL QLGNKQEALE       300
     LSKIPTDERL ERVKEGKLDD GLISLYFHFG RYLLISCSRP GTLPANLQGI WNKHHTSPWG       360
     CKFTININTE MNYWPAETCN LSDCHTPLFD LIEKMREPGR HTAKVMYDCG GFVAHHNVDL       420
     WGDTAPQDHW MPATVWPMGA AWLCLHLWEH YEFTCDLKFL KKAYETLKES AEFFVDYLIE       480
     DRNGYLVTCP SVSPENTYRL ESGETGSLCI GPSMDSQIIY ALFSSCIEAS ELLNTDKEFA       540
     ETLISLRERL PKPSIGKYGQ IMEWAEDYDE VEPGHRHISQ LFALHPSNQI TVKDTPQLAK       600
     AARNTLERRL AHGGGHTGWS RAWIINFWAR LEEGEKAYEN INALLAKSTL INLLDNHPPF       660
     QIDGNFGGAA GVAEMLVQSH SNEINIFPAM PKQWSEGEVT GLCARGGFEL SIKWTENKAY       720
     VTVTSKAGNR CIIRTPRFAH TSEEVSVEKL QDNVIAFDTI KGEDYHLEF                   769
//

If you have problems or comments...

PBIL Back to PBIL home page