(data stored in ACNUC7421 zone)

EMBL: CP002160.PE571

CP002160.PE571       Location/Qualifiers
FT   CDS             735255..735902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0591"
FT                   /product="transaldolase"
FT                   /note="KEGG: cac:CAC1347 putative translaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50362"
FT                   /db_xref="GOA:D9SR74"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR74"
FT                   /inference="protein motif:TFAM:TIGR00875"
FT                   /protein_id="ADL50362.1"
FT                   /translation="MKIFIDTANVDEIIEANDMGVICGVTTNPSLVAKEGKDFNEVIKT
FT                   IASIVDGPISGEVNSDDAEGMIVEGREIAKIHKNMVVKIPMTKEGLKAVKVLTAEGIKT
FT                   NVTLVFSAAQALLAANAGATYVSPFVGRLDDIGSTGMELIEKIAYIFERQDIETEIIAA
FT                   SIRSSIHAIEAAEAGAHIATIPYGVLMNMAKHPLTDSGIERFKKDWADAFNK"
     MKIFIDTANV DEIIEANDMG VICGVTTNPS LVAKEGKDFN EVIKTIASIV DGPISGEVNS        60
     DDAEGMIVEG REIAKIHKNM VVKIPMTKEG LKAVKVLTAE GIKTNVTLVF SAAQALLAAN       120
     AGATYVSPFV GRLDDIGSTG MELIEKIAYI FERQDIETEI IAASIRSSIH AIEAAEAGAH       180
     IATIPYGVLM NMAKHPLTDS GIERFKKDWA DAFNK                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page