(data stored in ACNUC7421 zone)

EMBL: CP002160.PE574

CP002160.PE574       Location/Qualifiers
FT   CDS             738158..739330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0594"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; regulatory protein MarR;
FT                   KEGG: cac:CAC3673 XylR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ADL50365"
FT                   /db_xref="GOA:D9SR77"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D9SR77"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ADL50365.1"
FT                   /translation="MTKIKKLDQETIKKINQNNVLYLLYRHDQLTKHDIAKKLGISIPT
FT                   VVTNINELIELGFVEEAGVGKSTGGRKPVIVKFLPDSRYSMGVVITKDYVRMVLTNLHF
FT                   EIIKEVSISIDEELQSIDYIIEAVKEFQKNVCEELSIDENKILGIGFSLPGTVNEKTLI
FT                   LENAINLGIKNIDFKNYDFNCPVYIENEANASAYAEYFVYPDKSNSKLIFVSITEGIGT
FT                   GIVFNSLLYKGANKRAGEWGHMTIVKDGKSCACGKNGCWEVYASSKALLKTYNKDTGLK
FT                   RRNISEIFMELDEDYKTQKVVDEYLEYLAEGIKNIILIMDPDKIVIGGEIAFYEDYIKE
FT                   ALNEKVYKPNAFFTAKDCKIEFTKLKANASVIGAALLPVMPLFFNNNITI"
     MTKIKKLDQE TIKKINQNNV LYLLYRHDQL TKHDIAKKLG ISIPTVVTNI NELIELGFVE        60
     EAGVGKSTGG RKPVIVKFLP DSRYSMGVVI TKDYVRMVLT NLHFEIIKEV SISIDEELQS       120
     IDYIIEAVKE FQKNVCEELS IDENKILGIG FSLPGTVNEK TLILENAINL GIKNIDFKNY       180
     DFNCPVYIEN EANASAYAEY FVYPDKSNSK LIFVSITEGI GTGIVFNSLL YKGANKRAGE       240
     WGHMTIVKDG KSCACGKNGC WEVYASSKAL LKTYNKDTGL KRRNISEIFM ELDEDYKTQK       300
     VVDEYLEYLA EGIKNIILIM DPDKIVIGGE IAFYEDYIKE ALNEKVYKPN AFFTAKDCKI       360
     EFTKLKANAS VIGAALLPVM PLFFNNNITI                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page