(data stored in ACNUC7421 zone)

EMBL: CP002160.PE6

CP002160.PE6         Location/Qualifiers
FT   CDS             4849..6759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Clocel_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="SMART: DNA topoisomerase II; ATP-binding region
FT                   ATPase domain protein; TIGRFAM: DNA gyrase, B subunit;
FT                   KEGG: cno:NT01CX_0862 DNA gyrase subunit B; PFAM: DNA
FT                   topoisomerase type IIA subunit B region 2 domain protein;
FT                   ATP-binding region ATPase domain protein; TOPRIM
FT                   domain-containing protein; DNA gyrase subunit B domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Clocel_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ADL49797"
FT                   /db_xref="GOA:D9SML2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D9SML2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ADL49797.1"
FT                   /translation="MTDKKQSYDASQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVYEI
FT                   VDNSIDEALAGFCKNIDVIIHEDNSISVKDDGRGMPVGMHAKMNRPAVEVIMTILHAGG
FT                   KFGGGGYKVSGGLHGVGASVVNALSETCIVTVSIDGKIHRQEFHRGNVATELEVIGETE
FT                   EHGTEVFFTPDHEIFETLEFDYDTLVQRLRELAFLNKGINISIEDRRNDKSDSFHYDGG
FT                   IKSFVSYLNRNKEALFPEPIYIEGIQNDILVEIALQYNDTYQENIFSFANNIDTAEGGT
FT                   HLAGFKNAMTRVINDYARKFGFLKENDKNLSGEDVREGLTAIISVKIPEPEFEGQTKTK
FT                   LGNSEVRGIVDSILGGSVSTFLEENPSVGKIIVDKALTASRAREAAKKARELTRRKSIL
FT                   ESTSLPGKLADCSSKDPSECEIYIVEGDSAGGSAKQGRNRRFQAILPLRGKIMNVEKQR
FT                   LDKILGSDTIRSMITAFGAGIGKDFDLDKLRYHRIIIMTDADVDGAHIRTLLLTFFYRY
FT                   MRDMIEKGHVYIAQPPLYKVSRNKKEWYAYNDDELKDILKDIGGKDNSTVIQRYKGLGE
FT                   MDAQQLWDTTMDPEHRLLLKVDMGEAMMADEIFTILMGEKVEPRREFIQENAKNVVNLD
FT                   V"
     MTDKKQSYDA SQIQVLEGLE AVRKRPGMYI GSTSSRGLHH LVYEIVDNSI DEALAGFCKN        60
     IDVIIHEDNS ISVKDDGRGM PVGMHAKMNR PAVEVIMTIL HAGGKFGGGG YKVSGGLHGV       120
     GASVVNALSE TCIVTVSIDG KIHRQEFHRG NVATELEVIG ETEEHGTEVF FTPDHEIFET       180
     LEFDYDTLVQ RLRELAFLNK GINISIEDRR NDKSDSFHYD GGIKSFVSYL NRNKEALFPE       240
     PIYIEGIQND ILVEIALQYN DTYQENIFSF ANNIDTAEGG THLAGFKNAM TRVINDYARK       300
     FGFLKENDKN LSGEDVREGL TAIISVKIPE PEFEGQTKTK LGNSEVRGIV DSILGGSVST       360
     FLEENPSVGK IIVDKALTAS RAREAAKKAR ELTRRKSILE STSLPGKLAD CSSKDPSECE       420
     IYIVEGDSAG GSAKQGRNRR FQAILPLRGK IMNVEKQRLD KILGSDTIRS MITAFGAGIG       480
     KDFDLDKLRY HRIIIMTDAD VDGAHIRTLL LTFFYRYMRD MIEKGHVYIA QPPLYKVSRN       540
     KKEWYAYNDD ELKDILKDIG GKDNSTVIQR YKGLGEMDAQ QLWDTTMDPE HRLLLKVDMG       600
     EAMMADEIFT ILMGEKVEPR REFIQENAKN VVNLDV                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page